KEGG   Pan paniscus (bonobo): 100984958Help
Entry
100984958         CDS       T02283                                 

Gene name
GPX8
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00480  Glutathione metabolism
pps00590  Arachidonic acid metabolism
pps01100  Metabolic pathways
pps04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100984958 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100984958 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100984958 (GPX8)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100984958 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 100984958
NCBI-ProteinID: XP_003827410
UniProt: A0A2R9B736
Position
5
AA seq 209 aa AA seqDB search
MEPLAAYPLKCSGPRAKVFAVLLSMVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK
EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPIEVIRPDIAALVRQVIIKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcttgcagcttacccgctaaaatgttccgggcccagagcaaaggtatttgca
gttttgctgtctatggttctatgcacagtaacgctatttcttctacaactaaaattcctc
aaacctaaaatcaacagcttttatgcctttgaagtgaaggatgcaaaaggaagaaccgtt
tctctggaaaagtataaaggcaaagtttcactagttgtaaacgtggccagtgactgccaa
ctcacagacagaaattacttagggctgaaggaactgcacaaagagtttggaccatcccac
ttcagcgtgttggcttttccctgcaatcagtttggagaatcggagccccgcccaagcaag
gaagtagaatcttttgcaagaaaaaactacggagtaacattccccatcttccacaagatt
aagattctaggatctgaaggagaacctgcatttagatttcttgttgattcttcaaagaag
gaaccaaggtggaatttttggaagtatcttgtcaaccctgagggtcaagttgtgaagttc
tggaggccagaggagcccattgaagtcatcaggcctgacatagcagctctggttagacaa
gtgataataaaaaagaaagaggatctatga

DBGET integrated database retrieval system