KEGG   Pan paniscus (bonobo): 100984991
Entry
100984991         CDS       T02283                                 

Gene name
HNRNPA3
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A3
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03040  Spliceosome
pps05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100984991 (HNRNPA3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100984991 (HNRNPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pps03019]
    100984991 (HNRNPA3)
   03041 Spliceosome [BR:pps03041]
    100984991 (HNRNPA3)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100984991 (HNRNPA3)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100984991 (HNRNPA3)
Spliceosome [BR:pps03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    100984991 (HNRNPA3)
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 PHM7_cyt
Other DBs
NCBI-GeneID: 100984991
NCBI-ProteinID: XP_003815573
UniProt: A0A2R8ZSN7
Position
2B
AA seq 378 aa
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTV
DKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRG
GNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQG
GGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
GGGYGSGGGSGGYGSRRF
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggaggtaaaaccgccgcccggtcgcccccagcccgactccggccgtcgccgtcgccgc
cggggggaggagggccatgatccaaaggaaccagagcagttgagaaaactgtttattggt
ggtctgagctttgaaactacagatgatagtttaagagaacattttgagaaatggggcaca
ctcacagattgtgtggtgatgagagacccccaaacaaaacgttccaggggctttggtttt
gtgacttattcttgtgttgaagaggtggatgcagcaatgtgtgctcgaccacacaaggtt
gatgggcgtgtagtggaaccaaagagagctgtttctagagaggattctgtaaagcctggt
gcccatctaacagtgaagaaaatttttgttggtggtattaaagaagatacagaagaatat
aatttgagagactactttgaaaagtatggcaagattgaaaccatagaagttatggaagac
aggcagagtggaaaaaagagaggatttgcttttgtaacttttgatgatcatgatacagtt
gataaaattgttgttcagaaataccacactattaatgggcataattgtgaagtgaaaaag
gccctttctaaacaagagatgcagtctgctggatcacagagaggtcgtggaggtggatct
ggcaattttatgggtcgcggagggaactttggaggtggtggaggtaattttggccgtggt
ggaaactttggtggaagaggaggctatggtggtggaggtggtggcagcagaggtagttat
ggaggaggtgatggtggatataatggatttggaggtgatggtggcaactatggcggtggt
cctggttatagtagtagagggggctatggtggtggtggaccaggatatggaaaccaaggt
ggtggatatggtggaggtggaggatatgatggttacaatgaaggaggaaattttggcggt
ggtaactatggtggtggtgggaactataatgattttggaaattatagtggacaacagcaa
tcaaattatggacccatgaaagggggcagttttggtggaagaagctcgggcagtccctat
ggtggtggttatggatctggtggtggaagtggtggatatggtagcagaaggttctaa

DBGET integrated database retrieval system