KEGG   Pan paniscus (bonobo): 100985092
Entry
100985092         CDS       T02283                                 

Gene name
PSMD9
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 9
  KO
K06693  26S proteasome regulatory subunit N4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03050  Proteasome
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100985092 (PSMD9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100985092 (PSMD9)
   05012 Parkinson disease
    100985092 (PSMD9)
   05016 Huntington disease
    100985092 (PSMD9)
   05017 Spinocerebellar ataxia
    100985092 (PSMD9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:pps03051]
    100985092 (PSMD9)
Proteasome [BR:pps03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     100985092 (PSMD9)
SSDB
Motif
Pfam: Nas2_N PDZ_6 PDZ_2 PDZ GRASP55_65
Other DBs
NCBI-GeneID: 100985092
NCBI-ProteinID: XP_003832401
UniProt: A0A2R9A0N0
Position
12
AA seq 223 aa
MSDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDMLESQKGIGMNEPLVDCE
GYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAM
SRKLGQSESQGPPQAFAKVNSISPGSPASIAGLQADDEIVEFGSVNTQNFQSLHNIGSVV
QHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR
NT seq 672 nt   +upstreamnt  +downstreamnt
atgtccgacgaggaagcgaggcagagcggaggctcctcgcaggccggcgccgtgactgtc
agcgacgtccaggagctgatgcggcgcaaggaggagatagaagcgcagatcaaggccaac
tatgacatgctggaaagccaaaaaggcattgggatgaacgagccgctggtggactgtgag
ggctacccccggtcagacgtggacctgtaccaagtccgcaccgccaggcacaacatcata
tgcctgcagaatgatcacaaggcagtgatgaagcaggtggaggaggccctgcaccagctg
cacgctcgcgacaaggagaagcaggcccgggacatggctgaggcccacaaagaggccatg
agccgcaaactgggtcagagtgagagccagggccctccacaggccttcgccaaagtgaac
agcatcagccccggctccccagccagcatcgcgggtctgcaagcggatgatgagattgtg
gagttcggctctgtgaacacccagaacttccagtcactgcataacattggcagtgtggtg
cagcacagtgaggggaagcccctgaatgtgacagtgatccgcaggggggaaaaacaccag
cttagacttgttccaacacgctgggcgggaaaaggactgctgggctgcaacattattcct
ctgcaaagatga

DBGET integrated database retrieval system