KEGG   Pan paniscus (bonobo): 100985211Help
Entry
100985211         CDS       T02283                                 

Gene name
MGAT2
Definition
(RefSeq) mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00510  N-Glycan biosynthesis
pps01100  Metabolic pathways
Module
pps_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100985211 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pps01003]
    100985211 (MGAT2)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     100985211 (MGAT2)
Glycosyltransferases [BR:pps01003]
 Glycan extension
  N-Glycan
   100985211 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 100985211
NCBI-ProteinID: XP_003831794
Position
14
AA seq 447 aa AA seqDB search
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAAPLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQVPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaggttccgcatctacaaacggaaggtgctaatcctgacgctcgtggtggccgcctgc
ggcttcgtcctctggagcagcaatgggcgacaaaggaagaacgaggccctcgccccaccg
ttgctggacgccgaacccgcgcggggtgccggcggccgcggcggggaccacccctctgtg
gctgtgggcatccgcagggtctccaacgtgtcggcggctcccctggtcccggcggtcccc
cagcccgaggcggacaacctgacgctgcggtaccggtccctggtgtaccagctgaacttt
gatcagacgctgaggaatgtagataaggctggcacctgggccccccgggagctggtgctg
gtggtccaggtgcataaccggcccgaatacctcagactgctgctggactcacttcgaaaa
gcccagggaattgacaacgtcctcgtcatctttagccatgacttctggtcgaccgagatc
aatcagctgatcgccggagtgaatttctgtccggttctgcaggtgttctttcctttcagc
attcagttgtaccctaacgagtttccaggtagtgaccctagagattgtcccagagacctg
ccgaagaatgccgctttgaaattggggtgcatcaatgctgagtatcccgactccttcggc
cattatagagaggccaaattctcccagaccaaacatcactggtggtggaagctgcatttt
gtgtgggaaagagtgaaaattcttcgagattatgctggccttatacttttcctagaagag
gatcactacttagccccagacttttaccatgtcttcaaaaagatgtggaaactgaagcag
caagagtgccctgaatgtgatgttctctccctggggacctatagtgccagtcgcagtttc
tatggcatggctgacaaggtagatgtgaaaacttggaaatccacagagcacaatatgggt
ctagccttgacccggaatgcctatcagaagctgatcgagtgcacagacactttctgtact
tatgatgattataactgggactggactcttcaatacttgactgtatcttgtcttccaaaa
ttctggaaagtgctggttcctcaagttcctaggatttttcatgctggagactgtggtatg
catcacaagaaaacctgtagaccatccactcagagtgcccaaattgagtcactcttaaat
aataacaaacaatacatgtttccagaaactctgactatcagtgagaagtttactgtggta
gccatttccccacctagaaaaaatggagggtggggagatattagggaccatgaactctgt
aaaagttatagaagactgcagtga

DBGET integrated database retrieval system