KEGG   Pan paniscus (bonobo): 100985431Help
Entry
100985431         CDS       T02283                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  thrombospondin 2/3/4/5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04512  ECM-receptor interaction
pps05144  Malaria
pps05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100985431 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100985431 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100985431 (THBS3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100985431 (THBS3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100985431 (THBS3)
   05144 Malaria
    100985431 (THBS3)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100985431 (THBS3)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100985431 (THBS3)
  Exosomal proteins of colorectal cancer cells
   100985431 (THBS3)
  Exosomal proteins of bladder cancer cells
   100985431 (THBS3)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   100985431 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 100985431
NCBI-ProteinID: XP_003817107
Position
1
AA seq 956 aa AA seqDB search
METQELRGALALLLLCFFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctttgctttttcgcatct
gccagtcaggatctgcaggtaattgacctgctgactgtgggcgagtctcggcagatggta
gctgtggcagagaagatccggacagccttgctcactgctggggacatctacctcttatcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctattctcgccaagac
aacactcgatggctggaggcctctgttgtaggcaagatcaacaaagtactggtgcgatac
cagcgggaggatggcaaagtccacgccgtgaacctacagcaagcgggcctggctgatggg
cgcacacacacagttctcctgcgactccgaggtccctccagacccagccctgccctacat
ctctacgtggactgcaaactgggtgaccaacatgcaggccttccagcactggcccccatt
cctccagcggaggtcgatgggctggagattaggactggacagaaggcgtatttgaggatg
cagggctttgtggaatctatgaaaattattctgggtgggtccatggcccgggtaggagcc
ctgagtgagtgtccattccaaggggacgagtccatccacagtgcagtgaccaatgcactg
cactccattctaggggagcagaccaaggcgctggtcacccaactcaccctcttcaaccag
atcctggtggagctgcgggatgatatacgagaccaggtgaaggaaatgtccctgatccga
aacaccattatggagtgtcaggtgtgcggcttccatgagcagcgttcccactgcagcccc
aatccctgcttccgaggtgtggactgcatggaagtgtacgagtacccaggctaccgctgt
gggccctgcccccctggcctgcagggcaacggcacccactgcagtgacatcaatgagtgt
gctcacgctgacccctgtttcccgggctccagctgcatcaacaccatgcccggcttccac
tgtgaggcctgtcctcgagggtacaagggcacacaggtgtctggtgtgggcattgactat
gcccgggccagcaaacaggtctgcaatgacatcgatgaatgcaacgatggcaacaatggt
ggctgtgacccaaactccatctgcaccaacactgtgggctctttcaagtgtggtccctgc
cgcctgggtttcctgggcaaccagagccagggctgcctcccagcccggacctgccacagc
ccagcccacagcccctgccacatccatgctcactgtctctttgaacgcaatggtgcagtg
tcctgccagtgtaacgtgggctgggctgggaatgggaacgtgtgtgggactgacacagac
atcgatggctacccagaccaagcactgccctgcatggacaacaacaaacactgcaaacag
gacaactgccttttgacacccaactctgggcaggaagatgctgataatgatggtgtgggg
gaccagtgtgatgatgatgctgatggggatgggatcaagaatgttgaggacaactgccgg
ctgttccccaacaaagaccagcagaactcagatacagattcatttggtgatgcctgtgac
aattgccccaacgttcccaacaatgaccagaaggacacagatggcaatggggaaggagat
gcctgtgacaacgacgtggatggggatggcatccccaatggattggacaattgccctaaa
gtccccaacccactacagacagacagggatgaggacggggtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgatactaatgaagacagcgatggggatgggcatcaggacaccaaggacaactgccca
cagctgccaaatagctcccagctggactctgataacgatggacttggagatgagtgtgat
ggggatgatgacaatgatggcatcccagattatgtgcctcctggtcctgataactgccgc
ctggtacccaatcccaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgag
gatgactttgacaatgatgcggtggtcgaccccctggatgtgtgtcctgaaagtgcagag
gtaacgcttacggattttcgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgacccaaactgggttgtgctcaaccagggcatggaaatcgttcagaccatgaac
agtgaccctggcttggcagttggatacacggccttcaatggtgtggactttgaaggcacc
ttccatgtgaacacagtgactgatgatgactacgcaggctttctcttcagttatcaagac
agtggccgcttctacgtagtcatgtggaagcagaccgagcagacctactggcaggctaca
cccttccgggcggttgcccagcccgggctgcagctcaaggcagtgacatcagtgtctggc
ccaggtgagcacctccgaaatgccctgtggcatactggccacacccctgatcaggtacga
ctgctgtggacagacccacgaaatgtgggctggcgggacaagacctcctatcgctggcag
cttctgcaccggcctcaagttggctacattcgggtgaagctctatgagggaccccagctt
gtggcggattctggggtgatcattgacacatccatgcgaggggggcgtcttggtgtattc
tgcttctcccaagaaaacataatttggtccaatctccagtatcgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagggtgtga

DBGET integrated database retrieval system