KEGG   Pan paniscus (bonobo): 100985469
Entry
100985469         CDS       T02283                                 

Gene name
MME
Definition
(RefSeq) membrane metalloendopeptidase
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04614  Renin-angiotensin system
pps04640  Hematopoietic cell lineage
pps04974  Protein digestion and absorption
pps05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100985469 (MME)
  09152 Endocrine system
   04614 Renin-angiotensin system
    100985469 (MME)
  09154 Digestive system
   04974 Protein digestion and absorption
    100985469 (MME)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100985469 (MME)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100985469 (MME)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100985469 (MME)
   04090 CD molecules [BR:pps04090]
    100985469 (MME)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     100985469 (MME)
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M13: neprilysin family
   100985469 (MME)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100985469 (MME)
CD molecules [BR:pps04090]
 Proteins
  100985469 (MME)
SSDB
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Other DBs
NCBI-GeneID: 100985469
NCBI-ProteinID: XP_003806144
UniProt: A0A2R8ZJ45
Position
3
AA seq 750 aa
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATAEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMTSVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgggcaaatcagaaagtcagatggatataactgatatcaacactccaaagccaaagaag
aaacagcgatggaccccgctggagatcagcctctcggtccttgtcctgctcctcaccatc
atagctgtgacaatgatcgcactctatgcaacctacgatgatggtatttgcaagtcatca
gactgcataaaatcagctgctcgactgatccaaaacatggatgccaccgctgagccttgt
acagactttttcaaatatgcttgcggaggctggttgaaacgtaatgtcattcccgagacg
agctcccgttacggcaactttgacattttaagagatgaactagaagtcgttttgaaagat
gtccttcaagaacccaaaactgaagatatagtagcagtgcagaaagcaaaaacattgtac
aggtcttgtataaatgaatctgctattgatagcagaggtggagagcctctactcaaactg
ttaccagacatatatgggtggccagtagcaacagaaaactgggagcaaaaatatggtgct
tcttggacagctgaaaaagctattgcacaactgaattctaaatatgggaaaaaagtcctt
attaatttgtttgttggcactgatgataagaattctgtgaatcatgtaattcatattgac
caacctcgacttggcctcccttctagagattactatgaatgcactggaatctataaagag
gcttgtacagcatatgtggattttatgacttctgtggccagattgattcgtcaggaagaa
agattgcccatcgatgaaaaccagcttgctttggaaatgaataaagttatggaattggaa
aaagaaattgccaatgctacggctaaacctgaagatcgaaatgatccaatgcttctttat
aacaagatgacattggcccagatccaaaataacttttcactagagatcaatgggaagcca
ttcagctggttgaatttcacaaatgaaatcatgtcaactgtgaatattagtattacaaat
gaggaagatgtggttgtttatgctccagaatatttaaccaaacttaagcccattcttacc
aaatattctgccagagatcttcaaaatttaatgtcctggagattcataatggatcttgta
agcagcctcagccgaacctacaaggagtccagaaatgctttccgcaaggccctttatggt
acaacctcagaaacagcaacttggagacgttgtgcaaactatgtcaatgggaatatggaa
aatgctgtggggaggctttatgtggaagcagcatttgctggagagagtaaacacgtggtc
gaggatttgattgcacagatccgagaagtttttattcagactttagatgacctcacttgg
atggatgccgagacaaaaaagagagctgaagaaaaggccttagcaattaaagaaaggatc
ggctatcctgatgacattgtttcaaatgataacaaactgaataatgagtacctcgagttg
aactacaaagaagatgaatacttcgagaacataattcaaaatttgaaattcagccaaagt
aaacaactgaagaagctccgagaaaaggtggacaaagatgagtggataagtggagcagct
gtagtcaatgcattttactcttcaggaagaaatcagatagtcttcccagccggcattctg
cagccccccttctttagtgcccagcagtccaactcattgaactatgggggcatcggcatg
gtcataggacacgaaatcacccatggcttcgatgacaatggcagaaactttaacaaagat
ggagacctcgttgactggtggactcaacagtctgcaagtaactttaaggagcaatcccag
tgcatggtgtatcagtatggaaacttttcctgggacctggcaggtggacagcaccttaat
ggaattaatacactgggagaaaacattgctgataatggaggtcttggtcaagcatacaga
gcctatcagaattatattaaaaagaatggcgaagaaaaattacttcctggacttgaccta
aatcacaaacaactatttttcttgaactttgcacaggtgtggtgtggaacctataggcca
gagtatgcggttaactccattaaaacagatgtgcacagtccaggcaatttcaggattatt
gggactttgcagaactctgcagagttttcagaagcctttcactgccgcaagaattcatac
atgaatccagaaaagaagtgccgggtttggtga

DBGET integrated database retrieval system