KEGG   Pan paniscus (bonobo): 100985633
Entry
100985633         CDS       T02283                                 

Gene name
CARD17
Definition
(RefSeq) caspase-1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps05014  Amyotrophic lateral sclerosis
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05164  Influenza A
pps05171  Coronavirus disease - COVID-19
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100985633 (CARD17)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100985633 (CARD17)
   04621 NOD-like receptor signaling pathway
    100985633 (CARD17)
   04623 Cytosolic DNA-sensing pathway
    100985633 (CARD17)
   04625 C-type lectin receptor signaling pathway
    100985633 (CARD17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100985633 (CARD17)
   05164 Influenza A
    100985633 (CARD17)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100985633 (CARD17)
   05135 Yersinia infection
    100985633 (CARD17)
   05133 Pertussis
    100985633 (CARD17)
   05134 Legionellosis
    100985633 (CARD17)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100985633 (CARD17)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100985633 (CARD17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100985633 (CARD17)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100985633 (CARD17)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     100985633 (CARD17)
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C14: caspase family
   100985633 (CARD17)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100985633 (CARD17)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 100985633
NCBI-ProteinID: XP_014202451
Position
11
AA seq 411 aa
MLSVSAHTRREERKAMADKVLKEKRKQFIRSAGEGTINGLLDELFETRVLSQEEIEIVKC
ENATVMDKARALLDSVIRKGALACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQ
VVLPSXPPPMPVWGNPAMPTSSGSGGSIKLCSLDEAKMIWKEKLTEIYPIMGKSSCTHLA
LIMFNKEFDSLSKRVGAEVDVIGMMMLLXNLGYKVDEKRNLTASEMTTELEVFALHQEHK
ASXSHGIREGICGKKYSEQVPDVLQLNEIFKTLNSKNCPSLKDKPKVIIIQACHVENHGV
VLVKDSAQASKNTSLPTPGDFEDDAINQVHIENDFIAFCSSTLDNVCWRHPAKGSFYYXV
IEQLQEYACSCDVEEIFHKVQLSFEQPDDKAQMPSTERMTLTRCFYLFLGH
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgctttcagtttcagctcacacaagaagggaggagagaaaagccatggcagacaaggtc
ctgaaggagaagagaaagcagtttatccgttcagcgggcgaaggtacaataaatggctta
ctggatgaattattcgagacaagggtgctgagccaggaagagatagagatagtaaaatgt
gaaaatgctacagttatggataaggcccgagctttgcttgactctgttattcggaaaggg
gctctggcatgccaaatttgcatcacatacatttgtgaagaagacagtcacctggcaggg
acgctgggactctcagcaggtccaacatctggaaatcaccttactacacaagattctcaa
gtagtacttccttcctagccaccgccaatgccagtgtggggcaaccctgctatgcctaca
tcctcaggctcaggaggaagcatcaagctttgctccctagacgaagctaaaatgatatgg
aaagaaaagttgacagagatttatccaataatgggcaagtcaagctgcacacatcttgct
ctcattatgtttaacaaagagtttgacagtctttctaaaagagtgggagctgaggttgat
gtcataggcatgatgatgctgctataaaatctggggtacaaggtggatgagaaaagaaat
ctcactgcttcggaaatgactacagagttggaggtatttgctctgcaccaagagcacaag
gcctctnggtctcatggtattcgggaaggcatttgtgggaagaaatactctgagcaagtc
ccagatgtattacaactcaatgaaatctttaaaacgttgaatagcaagaactgcccaagt
ttgaaggacaaacccaaggtgataatcatccaggcctgccatgttgagaaccatggtgtg
gtgttggtaaaagattcagcacaggcctctaaaaatacatctttaccaactccaggagat
tttgaggatgatgctattaatcaagtacacatagagaatgattttattgctttctgctct
tccacattagataatgtttgctggagacatcctgcaaagggctctttttattatngagtc
attgaacaactgcaagaatatgcctgttcctgtgatgtggaggaaattttccacaaggtt
caactttcatttgagcagccagatgataaagcacagatgcccagcactgagaggatgaca
ttgacaagatgtttctatctcttcttaggacattaa

KEGG   Pan paniscus (bonobo): 100985973
Entry
100985973         CDS       T02283                                 

Definition
(RefSeq) caspase-1-like
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps05014  Amyotrophic lateral sclerosis
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05164  Influenza A
pps05171  Coronavirus disease - COVID-19
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100985973
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100985973
   04621 NOD-like receptor signaling pathway
    100985973
   04623 Cytosolic DNA-sensing pathway
    100985973
   04625 C-type lectin receptor signaling pathway
    100985973
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100985973
   05164 Influenza A
    100985973
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100985973
   05135 Yersinia infection
    100985973
   05133 Pertussis
    100985973
   05134 Legionellosis
    100985973
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100985973
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100985973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100985973
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100985973
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     100985973
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C14: caspase family
   100985973
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100985973
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 100985973
NCBI-ProteinID: XP_008952066
Position
11
AA seq 380 aa
MILLKKRWLLINSLGEGTINGLPDELLETNVLSQEDTEIVKCENVTVMDKARALLDAVSR
KGARACEICITYICEEDRYLAGRLGLSAGKVPVWDNPAMPTSTGSGGSVKLCSLDEAKRI
WKENLTEIYPIMGKSSRTRLALIICNKEFDSLSKITGAEVDIIGMTMLLQNLGYKVDVKR
NLIAWEMTTELEAFAHRPEHKTSDSTFLVFLSHGVREGICGKKYSEQVPDILQLNEIFKM
LNSKNCPSLKDKPKVIIFEACCGENHGVVLVKDSLXVSENISLPTLGDFEDDAVKKAHIE
KDFIAFCSSASDNVSWRHPTQGSVFITRLIEHLQEYACSCDVEEIFCKVQLSFEQPDDKA
QMPSTERMTLTRRFYLFSGH
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatcctcctgaagaagagatggctgcttatcaattcattgggtgaaggtacaataaat
ggcttaccggatgaattattggagacaaatgtgctgagccaggaagacacagagatagta
aaatgtgaaaatgttacagttatggataaggcccgagctttgcttgacgctgtttctcgg
aaaggggcacgggcatgtgaaatttgcatcacatacatttgtgaagaagacaggtacctg
gcagggaggctgggactctcagcaggtaaggtgccagtgtgggacaaccctgctatgcct
acatccacaggctcaggaggaagcgtcaagctttgctccctagacgaagctaaaaggata
tggaaagaaaatttgacagagatttatccaataatgggcaagtcaagccgcacacgtctt
gctctcattatctgcaacaaagagtttgatagtctttctaaaataacgggagctgaggtt
gacatcataggcatgacgatgctgctgcaaaatctggggtacaaggtggacgtgaaaaga
aatctcattgcttgggaaatgactacagagctggaggcatttgctcaccgcccagagcac
aagacctctgacagcaccttcctggtgttcttgtctcatggtgttcgggaaggcatttgt
gggaagaagtactctgaacaagtccctgatatattacaactcaatgaaatatttaaaatg
ttgaatagcaagaactgcccaagtttgaaggacaaacccaaggtgatcatcttcgaggcc
tgctgtggtgagaaccatggtgtggtgttggtaaaagattcattatgagtctctgaaaat
atatctttaccaactctgggagattttgaggatgatgctgttaagaaagcccacatagag
aaggattttattgctttctgctcttccgcatcagataatgtctcttggagacatcccaca
cagggctctgtttttattacgagactcattgaacatctgcaagaatatgcctgttcctgt
gatgtggaggaaattttctgcaaggttcaactttcatttgagcagccagatgataaagca
cagatgcccagcactgaaaggatgactttgacaagacgtttctacctcttttcaggacat
taa

KEGG   Pan paniscus (bonobo): 100986637
Entry
100986637         CDS       T02283                                 

Gene name
CARD16, CASP1
Definition
(RefSeq) caspase-1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04613  Neutrophil extracellular trap formation
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps05014  Amyotrophic lateral sclerosis
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05135  Yersinia infection
pps05164  Influenza A
pps05171  Coronavirus disease - COVID-19
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100986637 (CARD16)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100986637 (CARD16)
   04621 NOD-like receptor signaling pathway
    100986637 (CARD16)
   04623 Cytosolic DNA-sensing pathway
    100986637 (CARD16)
   04625 C-type lectin receptor signaling pathway
    100986637 (CARD16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100986637 (CARD16)
   05164 Influenza A
    100986637 (CARD16)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100986637 (CARD16)
   05135 Yersinia infection
    100986637 (CARD16)
   05133 Pertussis
    100986637 (CARD16)
   05134 Legionellosis
    100986637 (CARD16)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100986637 (CARD16)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100986637 (CARD16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100986637 (CARD16)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100986637 (CARD16)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     100986637 (CARD16)
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C14: caspase family
   100986637 (CARD16)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100986637 (CARD16)
SSDB
Motif
Pfam: Peptidase_C14 CARD DUF3783
Other DBs
NCBI-GeneID: 100986637
NCBI-ProteinID: XP_008952009
Position
11
AA seq 388 aa
MGEGTINGLLDELLQTRVLNQEEMEKVKRENATAMDKTRALIDSVIPKGAQACQICITYI
CEEDNYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLC
SLEEAQRIWKEKSAEIYPIMDKSSRTRLALIICNEEFDTIPRRTGAEVDITGMTMLLQNL
GYSVDVKKNLTASDMTTELKAFAHRPEHKTSDSTFLVFMSHGIREGICGKKYSEQVPDVL
QLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDD
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFS
FEQPDGRVQMPTTERVTLTRCFYLFPGH
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgggtgaaggtacaataaatggcttactggatgaattattacagacaagggtgctgaac
caggaagagatggagaaagtaaaacgtgaaaatgctacagctatggataagactcgagct
ttgattgactccgttattccgaaaggggcacaggcatgccaaatttgcatcacatacatt
tgtgaagaagacaattacctggcagggacgctgggactctcagcagatcaaacatctgga
aattaccttaatatgcaagactctcaaggagtactttcttcctttccagctcctcaggca
gtgcaggacaacccagctatgcccacatcctcaggctcagaagggaatgtcaagctttgc
tccctagaagaagcgcaaaggatatggaaagaaaagtcggcagagatttatccaataatg
gacaagtcaagccgcacacgccttgctctcattatctgcaatgaagaatttgacactatt
cctagaagaactggagctgaggttgacatcacaggcatgacaatgctgctacaaaatctg
gggtacagcgtagatgtgaaaaaaaatctcaccgcttcggacatgactacagagctgaag
gcatttgcacaccgcccagagcacaagacctctgacagcacgttcctggtgttcatgtct
catggtattcgggaaggcatttgtgggaagaaatactctgagcaagtcccagatgtatta
caactcaatgcaatctttaacatgttgaataccaagaactgcccaagtctgaaggacaaa
ccgaaggtgatcatcatccaggcctgccgtggtgacagccctggtgtggtgtggtttaaa
gattcagtaggagtttctggaaacctatctttaccaactacagaagagtttgaggatgat
gctattaagaaagcccacatagagaaggattttatcgctttctgctcttccacaccagat
aatgtttcttggagacatcccacaatgggctctgtttttattggaagactcattgaacat
atgcaagaatatgcctgttcctgtgatgtggaggaaattttccgcaaggttcgattttca
tttgagcagccagatggtagagtgcagatgcccaccactgaaagagtgactttgacaaga
tgtttctacctcttcccaggacattaa

DBGET integrated database retrieval system