KEGG   Pan paniscus (bonobo): 100985755Help
Entry
100985755         CDS       T02283                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04218  Cellular senescence
pps04350  TGF-beta signaling pathway
pps04380  Osteoclast differentiation
pps04390  Hippo signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05140  Leishmaniasis
pps05142  Chagas disease (American trypanosomiasis)
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05220  Chronic myeloid leukemia
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05321  Inflammatory bowel disease (IBD)
pps05323  Rheumatoid arthritis
pps05410  Hypertrophic cardiomyopathy (HCM)
pps05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100985755 (TGFB2)
   04350 TGF-beta signaling pathway
    100985755 (TGFB2)
   04390 Hippo signaling pathway
    100985755 (TGFB2)
   04068 FoxO signaling pathway
    100985755 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100985755 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100985755 (TGFB2)
   04218 Cellular senescence
    100985755 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100985755 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100985755 (TGFB2)
   05206 MicroRNAs in cancer
    100985755 (TGFB2)
   05205 Proteoglycans in cancer
    100985755 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100985755 (TGFB2)
   05212 Pancreatic cancer
    100985755 (TGFB2)
   05225 Hepatocellular carcinoma
    100985755 (TGFB2)
   05226 Gastric cancer
    100985755 (TGFB2)
   05220 Chronic myeloid leukemia
    100985755 (TGFB2)
   05211 Renal cell carcinoma
    100985755 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100985755 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    100985755 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100985755 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    100985755 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100985755 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100985755 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100985755 (TGFB2)
   05161 Hepatitis B
    100985755 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100985755 (TGFB2)
   05144 Malaria
    100985755 (TGFB2)
   05145 Toxoplasmosis
    100985755 (TGFB2)
   05140 Leishmaniasis
    100985755 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    100985755 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100985755 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100985755 (TGFB2)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100985755 (TGFB2)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100985755 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 100985755
NCBI-ProteinID: XP_003814180
UniProt: A0A2R9ACA0
Position
1
AA seq 414 aa AA seqDB search
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaaatgccatcccgccc
actttctacagaccctacttcagaattgttcgatttgacgtctcagcaatggagaagaat
gcttccaatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccaga
gtgcctgaacaacggattgagctgtatcagattctcaagtccaaagatttaacatctcca
acccagcgctacatcgacagcaaagttgtgaaaacaagagcagaaggcgaatggctctcc
ttcgatgtaactgatgctgttcatgaatggcttcaccataaagacaggaacctgggattt
aaaataagcttacactgtccctgctgcacttttgtaccatctaataattacatcatccca
aataaaagtgaagaactagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttattgccctcctacagacttgagtcacaacagaccaaccggcggaag
aagcgtgctttggatgcagcctattgctttagaaatgtgcaggataattgctgcctacgt
ccactttacattgatttcaagagggatctagggtggaaatggatacacgaacccaaaggg
tacaatgccaacttctgtgctggagcatgcccgtatttatggagttcagacactcagcac
agcagggtcctgagcttatataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaagatttagaacctctaaccattctctactacattggcaaaacacccaagatt
gaacagctttctaatatgattgtaaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system