KEGG   Pan paniscus (bonobo): 100985799Help
Entry
100985799         CDS       T02283                                 

Gene name
RALGAPA1
Definition
(RefSeq) Ral GTPase activating protein catalytic alpha subunit 1
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: Rap_GAP
Motif
Other DBs
NCBI-GeneID: 100985799
NCBI-ProteinID: XP_003821237
UniProt: A0A2R9BTV8
Position
14
AA seq 2036 aa AA seqDB search
MFSKKPHGDVKKSTQKVLDTKKDALTRLKHLRIVIENAESIDLKQFFDQHFSHIYYVFFE
NFVTIEASLKQKGHKSQREELDAILFIFEKILQLLPERIHQRWQFHSIGLILKKLLHTGN
SLKIRREGVRLFLLWLQALQNNCSKEQLWMFSCLIPGFSAPQSEHGPRTLDNLINPPLNL
QETQVTIEEITPLVPPQSGDKGQEDLTSYFLEALLKYIVIQVKSLEWKNKENQERGFSFL
FSHFKKYYLPYIFPNICKENSLYHPILDIPQMRPKPHYVMIKKDAETNEAIYCTKEPFIK
ARVIVIRWLVSFWLEPKPHTGPHIPGMEGEVLPKNIQRAAASLVSREESKNDNADKADRT
TEPEQSHSNTSTLTEREPSSSSLCSIDEEHLTDIEIVRRVFSSKRSNVNFVTEIFRQAFL
LPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVITSSDLPCIENVTDHDISMEEGEK
REEENGTNTADHVRNSSWAKNGSYQGALHNASEEATEQNIRAGTQAVLQVFIINSSNIFL
LEPANEIKNLLDEHTDMCKRILNIYRYMVVQVSMDKKTWEQMLLVLLRVTESVLKMPSQA
FLQFQGKKNMTLAGRLAGPLFQTLIVAWIKANLNVYISRELWDDLLSVLSSLTYWEELAT
EWSLTMETLTKVLARNLYSLDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGW
SRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEETGN
EVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSQKLPPLNSDIGSSSANVPDLMD
EFIAERLRSGNASTMTRRGSSPGSLEIPKDLPDILNKQNQMRPIDDPGVPSEWTSPASAG
SSDLISSDSHSDSFSAFQYDGRKFDNFGFGADTGVTSSADVDSGSGHHQSAEEQEVASLT
TLHIDSETSSLNQQAFSAEVATITGSEGASPVHSPLGSRSQTPSPSTLNIDHMEQKDLQL
DEKLHHSVLQTPDDLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNSIMD
PEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDK
YKQGKLHAYKLICNTMKRRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFF
SLGLPGATMLIMDFIVAAGRVASSAFLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPD
VAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVHESHHPQIKEALNV
ICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASS
YEMDKRLVVSLLLCLLDWIMALPLKTLLQPFHATGAESDKTEKSVLNCIYKVLHGCVYGA
QCFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHG
LISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPELFESPNIQFF
VLNNTTLVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVS
GLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDV
LDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHF
NDLNMKAVEQDEPIPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLD
SRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQK
NKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRG
IIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINAS
RALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFSPAPYHHLPSDADH
NT seq 6111 nt NT seq  +upstreamnt  +downstreamnt
atgttctccaagaagccgcacggggacgtgaagaagtccacccagaaggtgctagacacc
aagaaggacgcactgactcgcctcaagcacctgcgcatcgtcatcgagaatgcagaatct
attgatcttaaacagtttttcgaccaacatttttcacatatatactatgtgttctttgaa
aattttgtgactattgaagctagtcttaaacagaaaggtcacaagtctcaaagagaggaa
ttggatgctatactttttatttttgagaaaattttacaacttcttccagaaagaattcat
cagcgatggcagtttcatagtattggattgattttaaagaagctacttcacacaggaaac
tccttaaagattaggcgggaaggtgttcgtcttttcttactatggttgcaagctcttcag
aataactgtagcaaagaacagctctggatgttttcatgcttaatccctggattttcagca
ccacagtctgaacatggacctcgaactttagataatctcattaatcctccactcaacctt
caagaaactcaagtcactatagaagaaatcactcctcttgtccccccacaatcaggagat
aaagggcaagaagatctcacaagctattttcttgaagcacttctaaaatacatagtcatt
caggtaaaaagtttagaatggaagaacaaagaaaaccaagaaaggggattttcatttttg
ttttcacattttaagaaatattacttgccttatatttttccaaacatctgtaaggaaaac
agtttatatcatcctatacttgacatcccgcagatgagaccaaagccacattatgtcatg
ataaagaaagatgctgaaaccaatgaagcaatctattgtacaaaggagcctttcattaag
gctcgtgttattgtcattcgttggctggtttctttctggctggagccaaaaccacataca
ggacctcatattcctgggatggaaggtgaagtcttgccaaagaatattcagagagcagct
gctagtttagtatccagagaagaaagcaaaaatgataatgctgataaagcagacagaact
acagaacccgaacagtctcattccaatacaagcactctcacggagcgagaacctagctca
tctagtctctgtagtattgatgaagaacatctcacagacattgaaatagttcgcagagtt
ttttcttctaaaaggagtaatgtaaactttgtgacagagatatttcgtcaggcattttta
ttaccaatttgtgaagcagcagctatgagaaaagtggtaaaagtatatcaagaatggatc
caacaagaggaaaaacctttgttcatgcaagagcctgaagaaattgtgatcacttcttca
gacctcccttgcattgaaaatgtcacagaccatgatatttcaatggaagaaggagaaaaa
agagaagaggaaaatgggaccaatactgctgatcatgttcgaaattccagttgggcaaaa
aacggctcctaccaaggtgctcttcataacgcctctgaagaagccacagaacaaaacata
cgagctggtacccaggcagttttgcaggtgttcattataaactcatcaaatatatttctt
cttgaacctgcaaatgaaataaaaaatcttctggatgaacacacagatatgtgtaaacgc
attcttaacatttatcggtacatggttgtacaagtatcaatggacaaaaagacttgggaa
cagatgctgcttgtgttgctcagagtcacggaatctgtactgaagatgccatcacaagct
tttctacagttccaagggaaaaaaaatatgaccttggcaggtcgacttgcaggaccactt
ttccagacccttatagttgcctggatcaaagcaaacctaaatgtgtacatctcccgagaa
ctttgggatgacttactgtcagtattgtcatcgttgacctattgggaagagttggccact
gagtggtcactgactatggagacattaactaaagttttagctaggaatttatatagtttg
gatctcagtgatttaccattggataagctgagtgaacagaaacaaaaaaagcacaaaggg
aaaggagttggacatgaatttcagaaagtttcagttgacaagtcattttctagaggatgg
agtcgtgatcagcctggccaagccccaatgagacagaggagtgcaacaaccactggttct
ccaggaaccgaaaaggcgaggagtatagtacggcaaaaaactgtcgatattgatgatgct
caaatacttccccgctcaactagagtcagacatttttcacaaagtgaagaaactggaaat
gaagtttttggtgctttgaatgaggagcagccattgcctcgaagtagcagcacttctgac
atcttggaaccattcactgttgaacgagccaaagtcaataaagaggacatgagccaaaaa
ctgcctcctcttaatagtgatattggcagcagcagtgctaatgttcctgatctgatggat
gagtttatagcagaacgacttcgaagtggtaatgcctcgactatgacaagaagaggaagt
agtccaggcagcctggaaattcccaaagacctccctgatattctaaacaagcagaaccag
atgcgccctattgatgacccaggtgtgccctcagaatggacttctcctgccagtgcaggg
agcagtgatcttatcagctcagatagtcattcggattctttcagcgctttccaatatgat
ggccgaaaatttgacaattttggctttggagccgacactggggttacgtcctctgctgat
gtggattcaggttctggccatcatcagagtgctgaagagcaggaagtggctagtctaact
actcttcatatagattctgaaacaagcagtcttaatcagcaagctttctctgctgaagtt
gcaactattactggttcagaaggtgcttccccagtccattcacctctgggctccaggtca
cagactccttccccttctacactgaatatagatcacatggaacagaaggatctgcagctc
gatgagaagctccaccactctgttcttcagacaccagatgatctagaaattagtgaattt
ccatcagaatgttgtagtgtgatggcaggaggtactctgactggatggcatgctgatgtt
gctactgtaatgtggcgaagaatgctaggcattttgggagatgtaaattcaatcatggat
cctgaaatacatgctcaagtttttgattacctctgtgaactttggcagaatctagctaag
attagagataacctcggcatttcaactgataacctgacctccccttctccaccagtttta
attcctccactgagaattcttacaccttggctttttaaggcaaccatgttgactgataaa
tataaacaaggtaaattacatgcatataaacttatttgtaatacaatgaaaagaagacaa
gatgtttctccaaatagagattttctaacacatttctacaatataatgcattgtggatta
cttcatattgaccaggatattgtcaatacaatcatcaaacactgctcacctcaatttttt
tcacttggtttgcctggtgccacaatgcttattatggattttattgtagcagctggtaga
gtggcttcttcagcttttctcaatgcaccaagagtagaagcacaagttcttctgggatct
ttggtttgctttcccaacttatactgtgaactgccttctcttcatcccaacattcctgat
gttgctgtgtctcagtttacagatgttaaggaacttataatcaaaactgtattaagctcg
gcaagagatgagccctctggtcctgcacgatgtgtagcactttgtagtttaggtatttgg
atttgtgaagaactagtccatgagtctcatcatcctcaaattaaggaagctctgaatgtg
atttgtgtttccttaaagtttactaataaaacagtagcccacgtagcttgtaacatgctt
cacatgctggttcattatgtacctagacttcagatttaccagcctgattctcccttgaaa
attattcaaatcctaatagctaccatcacccatcttttaccaagtacagaggcttcatct
tatgaaatggacaagaggttggtagtatctttacttctctgccttctggactggatcatg
gccttacctctaaagacactgctccaaccatttcatgctacgggagcagaaagcgataaa
acagaaaaatctgttctcaattgcatttataaggttttacatgggtgtgtttatggagct
cagtgttttagcaatccaaggtattttcccatgagcctctctgatttggcatctgtagat
tatgatccttttatgcatttggaaagtctgaaagagcctgagcctctgcactctcctgac
tcagaacgatcttctaaactccagccagtaacagaagtgaaaactcaaatgcagcatgga
ttaatctctatagcagcccgcactgttattacacatctggtaaatcacctgggccattat
ccaatgagcggtggtcctgctatgctaacaagtcaggtgtgtgaaaatcacgacaatcat
tacagtgaaagtactgaactttctcctgaactctttgagagtccaaatatccagttcttt
gtgttaaataatacaaccttagtgtcctgtatccagatcagatcagaagagaatatgcct
ggaggaggtttatctgctggccttgcatcagccaattcaaatgtcagaatcatagtacgt
gatctctctggaaaatattcatgggattctgctatactgtatggcccacctcctgtaagt
ggcttgtcagaacctacatctttcatgctttcattgtctcaccaagagaagccagaagag
cctccgacatctaatgaatgcttagaagatataacagtaaaagatggactttctctccag
tttaaaagatttagagaaactgtaccaacttgggatacaataagagatgaagaagatgtt
cttgatgagctcttgcagtatttgggtgttactagtcctgaatgcttacagagaactgga
atctcacttaatattcctgctccacaacctgtgtgcatttctgaaaaacaagaaaatgat
gttattaatgctatccttaagcaacatacagaagaaaaagaatttgttgagaagcacttt
aatgacttaaacatgaaagctgtggaacaagatgaaccaatacctcaaaaacctcagtca
gcattttattattgcagattgcttcttagtatattgggaatgaattcctgggacaaacgg
aggagctttcatctcctgaagaaaaatgaaaagctacttagagaacttaggaacttggat
tcaaggcagtgccgagagacacacaagattgcagtattttatgttgctgaaggacaagaa
gacaaacactccattctcaccaatacaggaggaagtcaagcatatgaagattttgtagct
ggtcttggttgggaggtaaatcttacaaaccattgtggttttatgggaggactacaaaaa
aacaaaagcactggattgaccactccatattttgctacctctacagtagaagtaatattt
catgtgtcaacaagaatgccttctgattctgatgattctttgaccaaaaaattgagacat
ttgggaaatgatgaagtgcacattgtttggtcagagcatactagagactacaggagagga
attattcccacagaatttggtgatgtccttattgtaatatatccaatgaaaaatcacatg
ttcagtattcagataatgaaaaaaccagaggttcccttctttggtcccctttttgatggt
gctattgtgaatggaaaggttctacccattatggttagagcaacagctataaatgcaagc
cgtgctctgaaatctctgattccattgtatcaaaacttctatgaggagagagcacgatac
ctgcaaacaattgtccagcaccacttagaaccaacaacatttgaagattttgcagcacag
gttttttctccagctccctaccaccatttaccatctgatgccgatcattaa

DBGET integrated database retrieval system