KEGG   Pan paniscus (bonobo): 100985851Help
Entry
100985851         CDS       T02283                                 

Gene name
USF1
Definition
(RefSeq) upstream transcription factor 1
  KO
K09106  upstream stimulatory factor
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100985851 (USF1)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    100985851 (USF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Rootletin
Motif
Other DBs
NCBI-GeneID: 100985851
NCBI-ProteinID: XP_003811906
UniProt: A0A2R9AIR1
Position
1
AA seq 310 aa AA seqDB search
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP
STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP
RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK
GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
LEVVIKNDSN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcagcagaaaacagctgaaacggaagaggggacagtgcagattcaggaaggt
gcagtggctactggggaagacccaaccagtgtggctattgccagcatccagtcagctgcc
accttccctgaccccaacgtcaagtacgtcttccgaactgagaatgggggccaggtgatg
tacagggtgatccaggtgtctgaggggcagctggatggccaaactgagggaactggcgcc
atcagtggctaccctgccactcaatccatgacccaggcggtgatccagggtgctttcacc
agtgatgatgcagttgacacggaggggacagctgctgagacgcactatacttacttcccc
agcacggcagtgggagatggggcagggggtaccacatcggggagtacagctgctgttgtt
actacccagggctcagaggcactgctggggcaggcgacccctcctggcactggtcaattc
tttgtgatgatgtcaccacaagaagtactgcagggaggaagccagcgctcaattgcccct
aggactcacccttattccccgaagtcagaagctccccggacgactcgggatgagaaacgc
agggctcagcataatgaagtggagcgccgccgccgagacaagatcaacaactggatcgtg
cagctctccaagataatcccagactgctctatggagagcaccaagtctggccagagtaaa
ggtgggattctatccaaagcttgtgattatatccaggagcttcggcagagtaaccaccgc
ttgtctgaagaactgcagggacttgaccaactgcagctggacaatgacgtgcttcgacaa
caggtggaagatcttaaaaacaagaatctgctgcttcgagctcagttgcggcaccacgga
ttagaggtcgtcatcaagaatgacagcaactaa

DBGET integrated database retrieval system