KEGG   Pan paniscus (bonobo): 100985885
Entry
100985885         CDS       T02283                                 

Gene name
NFE2L2
Definition
(RefSeq) nuclear factor, erythroid 2 like 2
  KO
K05638  nuclear factor erythroid 2-related factor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04141  Protein processing in endoplasmic reticulum
pps05012  Parkinson disease
pps05200  Pathways in cancer
pps05225  Hepatocellular carcinoma
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100985885 (NFE2L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100985885 (NFE2L2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100985885 (NFE2L2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100985885 (NFE2L2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100985885 (NFE2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100985885 (NFE2L2)
   03029 Mitochondrial biogenesis [BR:pps03029]
    100985885 (NFE2L2)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    100985885 (NFE2L2)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    100985885 (NFE2L2)
SSDB
Motif
Pfam: bZIP_Maf bZIP_1 bZIP_2 T3SS_basalb_I
Other DBs
NCBI-GeneID: 100985885
NCBI-ProteinID: XP_003815576
UniProt: A0A2R9BKQ1
Position
2B
AA seq 589 aa
MDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQL
DEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVS
SATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPE
LQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSS
ILSTEDPNQLTANSLNSDATVNTDFGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGP
IDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDTLLGLSDS
EVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGH
RKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLA
LIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQ
LSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggatttgattgacatactttggaggcaagatatagatcttggagtaagtcgagaagta
tttgacttcagtcagcgacggaaagagtatgagctggaaaaacagaaaaaacttgaaaag
gaaagacaagaacaactccaaaaggagcaagagaaagcctttttcgctcagttacaacta
gatgaagagacaggtgaatttctcccaattcagccagcccagcacatccagtcagaaacc
agtggatctgccaactactcccaggttgcccacattcccaaatcagatgctttgtacttt
gatgactgcatgcagcttttggcgcagacattcccgtttgtagatgacaatgaggtttct
tcggctacgtttcagtcacttgttcctgatattcccggtcacatcgagagcccagtcttc
attgctactaatcaggctcagtcacctgaaacttctgttgctcaggtagcccctgttgat
ttagacggtatgcaacaggacattgagcaagtttgggaggagctattatccattcctgag
ttacagtgtcttaatattgaaaatgacaagctggttgagactaccatggttccaagtcca
gaagccaaactgacagaagttgacaattatcatttttactcatctataccctcaatggaa
aaagaagtaggtaactgtagtccacattttcttaatgcttttgaggattccttcagcagc
atcctctccacagaagaccccaaccagttgacagcgaactcattaaattcagatgccaca
gtcaacacagattttggtgatgaattttattctgctttcatagctgagcccagtatcagc
aacagcatgccctcacctgctactttaagccattcactctctgaacttctaaatgggccc
attgatgtttctgatctatcactttgcaaagctttcaaccaaaaccaccctgaaagcaca
gcagaattcaatgattctgactccggcatttcactaaacacaagtcccagtgtggcatca
ccagaacactcagtggaatcttccagctatggagacacactacttggcctcagtgattct
gaagtggaagagctagatagtgcccctggaagtgtcaaacagaatggtcctaaaacacca
gtacattcttctggggatatggtacaacccttgtcaccatctcaggggcagagcactcac
gtgcatgatgcccaatgtgagaacacaccagagaaagaattgcctgtaagtcctggtcat
cggaaaaccccattcacaaaagacaaacattcaagccgcttggaggctcatctcacaaga
gatgaacttagggcaaaagctctccatatcccattccctgtagaaaaaatcattaacctc
cctgttgttgacttcaacgaaatgatgtccaaagagcagttcaatgaagctcaacttgca
ttaattcgggatatacgtaggaggggtaagaataaagtggctgctcagaattgcagaaaa
agaaaactggaaaatatagtagaactagagcaagatttagatcatttgaaagatgaaaaa
gaaaaattgctcaaagaaaaaggagaaaatgacaaaagccttcacctactgaaaaaacaa
ctcagcaccttatatctcgaagttttcagcatgctacgtgatgaagatggaaaaccttat
tctcctagtgaatactccctgcagcaaacaagagatggcaatgttttccttgttcccaaa
agtaagaagccagatgttaagaaaaactag

DBGET integrated database retrieval system