KEGG   Pan paniscus (bonobo): 100985990
Entry
100985990         CDS       T02283                                 

Gene name
CALR
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04141  Protein processing in endoplasmic reticulum
pps04145  Phagosome
pps04612  Antigen processing and presentation
pps05142  Chagas disease
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100985990 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100985990 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100985990 (CALR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100985990 (CALR)
   05170 Human immunodeficiency virus 1 infection
    100985990 (CALR)
   05168 Herpes simplex virus 1 infection
    100985990 (CALR)
   05163 Human cytomegalovirus infection
    100985990 (CALR)
   05169 Epstein-Barr virus infection
    100985990 (CALR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100985990 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pps03110]
    100985990 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:pps04091]
    100985990 (CALR)
Chaperones and folding catalysts [BR:pps03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   100985990 (CALR)
Lectins [BR:pps04091]
 Calnexin / calreticulin
  100985990 (CALR)
SSDB
Motif
Pfam: Calreticulin DDHD
Other DBs
NCBI-GeneID: 100985990
NCBI-ProteinID: XP_003814880
UniProt: A0A2R8Z933
Position
19
AA seq 417 aa
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNGQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEQFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgctgctatccgtgccgctgctgctcggcctcctcggcctggccgtcgccgagcctgcc
gtctacttcaaggagcagtttctggacggagacgggtggacttcccgctggatcgaatcc
aaacacaagtcagattttggcaaattcgttctcagttccggcaagttctacggtgacgag
gagaaagataaaggtttgcagacaagccaggatgcacgcttttatgctctgtcggccagt
ttcgagcctttcagcaacaaaggccagacgctggtggtgcagttcacggtgaaacatgag
cagaacatcgactgtgggggcggctatgtgaagctgtttcctaatagtttggaccagaca
gacatgcacggagactcagaatacaacatcatgtttggtcccgacatctgtggccctggc
accaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggac
atccgttgcaaggatgatgagtttacacacctgtacacactgattgtgcggccagacaac
acctatgaggtgaagattgacaacggccaggtggagtctggctccttggaagacgattgg
gacttcctgccacccaagaagataaaggatcctgatgcttcaaaaccggaagactgggat
gagcgggccaagatcgatgatcccacagactccaagcctgaggactgggacaagcccgag
catatccctgaccctgatgctaagaagcccgaggactgggatgaagagatggacggagag
tgggaacccccagtgattcagaaccctgagtacaagggtgagtggaagccccggcagatc
gacaacccagattacaagggcacttggatccacccagaaattgacaaccccgagtattct
cctgatcccagtatctatgcctatgataactttggcgtgctgggcctggacctctggcag
gtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgctgag
cagtttggcaacgagacgtggggcgtaacaaaggcagcagagaaacaaatgaaggacaaa
caggacgaggagcagaggcttaaggaggaggaagaagacaagaaacgcaaagaggaggag
gaggcagaggacaaggaggatgatgaggacaaagatgaggatgaggaggatgaggaggac
aaggaggaagatgaggaggaagatgtccccggccaggccaaggacgagctgtag

DBGET integrated database retrieval system