KEGG   Pan paniscus (bonobo): 100986397Help
Entry
100986397         CDS       T02283                                 

Gene name
FKBP2
Definition
(RefSeq) FK506 binding protein 2
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pps03110]
    100986397 (FKBP2)
Enzymes [BR:pps01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100986397 (FKBP2)
Chaperones and folding catalysts [BR:pps03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    100986397 (FKBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 100986397
NCBI-ProteinID: XP_003828606
UniProt: A0A2R9BES8
Position
11
AA seq 142 aa AA seqDB search
MRLSWVRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL
EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK
IPGGATLVFEVELLKIERRTEL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgagctgggtccgggtcctgacagtactgtccatctgcctgagcgccgtggcc
acggccacgggggccgagggcaaaaggaagctgcagatcggggtcaagaagcgggtggac
cactgtcccatcaaatcgcgcaaaggggatgtcctgcacatgcactacacggggaagctg
gaagatgggacagagtttgacagcagcctgccccagaaccagccctttgtcttctccctt
ggcacaggccaggtcatcaagggctgggaccaggggctgctggggatgtgtgagggggaa
aagcgcaagctggtgatcccatccgagctagggtatggagagcggggagctcccccaaag
attccaggcggtgcaaccctggtgttcgaggtggagctgctcaaaatcgagcgacgaact
gagctgtaa

DBGET integrated database retrieval system