KEGG   Pan paniscus (bonobo): 100986414
Entry
100986414         CDS       T02283                                 

Gene name
SPRED2
Definition
(RefSeq) sprouty related EVH1 domain containing 2
  KO
K04703  sprouty-related, EVH1 domain-containing protein
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100986414 (SPRED2)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100986414 (SPRED2)
SSDB
Motif
Pfam: Sprouty WH1
Other DBs
NCBI-GeneID: 100986414
NCBI-ProteinID: XP_003830955
UniProt: A0A2R9CAX5
Position
2A
AA seq 418 aa
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKY
PDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRR
KEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGD
YTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgaccgaagaaacacacccagacgatgacagctatattgtgcgtgtcaaggctgtggtt
atgaccagagatgactccagcgggggatggttcccacaggaaggaggcgggatcagtcgc
gtcggggtctgtaaggtcatgcaccccgaaggcaatggacgaagcggctttctcatccat
ggtgaacgacagaaagacaaactggtggtattggaatgctatgtaagaaaggacttggtc
tacaccaaagccaatccaacgtttcatcattggaaggtcgataataggaagtttggactt
actttccaaagccctgctgatgcccgagcctttgacaggggagtaaggaaagcaatcgaa
gaccttatagaaggttcaacaacgtcatcttccaccatccataatgaagctgagcttggc
gatgatgacgtttttacaacagctacagacagttcttctaattcctctcagaagagagag
caacctactcggacaatctcctctcccacatcctgtgagcaccggaggatttataccctg
ggccacctccacgactcataccccacggaccactatcacctcgatcagccgatgccaagg
ccctaccgccaggtgagcttcccggacgacgacgaggagatcgtgcgcatcaacccccgg
gagaagatctggatgacggggtacgaggattaccggcacgcacccgtcaggggcaagtac
ccggacccctcggaggacgcggactcctcctacgtgcgcttcgccaagggcgaggtcccc
aagcatgactacaactacccctacgtggactcctcagactttggcctaggcgaggacccc
aaaggccgcgggggcagcgtgatcaagacacagccctcccggggcaagtcgcggcggcgg
aaggaggacggagagcgctcgcggtgcgtgtactgcagggacatgttcaaccacgaggag
aaccgcaggggccactgccaggacgcgcccgactccgtgagaacttgcatccgccgggtg
agctgcatgtggtgcgcggacagcatgctctatcactgtatgtcggaccccgagggagac
tatacagacccttgctcgtgcgatactagcgacgagaagttttgcctccggtggatggct
cttattgccttgtctttcctggccccctgtatgtgctgttacctgccccttcgggcctgc
taccactgcggagtgatgtgcaggtgctgtggcgggaagcacaaagcggccgcgtga

DBGET integrated database retrieval system