KEGG   Pan paniscus (bonobo): 100986585Help
Entry
100986585         CDS       T02283                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00564  Glycerophospholipid metabolism
pps00565  Ether lipid metabolism
pps00590  Arachidonic acid metabolism
pps00591  Linoleic acid metabolism
pps00592  alpha-Linolenic acid metabolism
pps01100  Metabolic pathways
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04072  Phospholipase D signaling pathway
pps04217  Necroptosis
pps04270  Vascular smooth muscle contraction
pps04370  VEGF signaling pathway
pps04611  Platelet activation
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04724  Glutamatergic synapse
pps04726  Serotonergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04921  Oxytocin signaling pathway
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100986585 (PLA2G4F)
   00565 Ether lipid metabolism
    100986585 (PLA2G4F)
   00590 Arachidonic acid metabolism
    100986585 (PLA2G4F)
   00591 Linoleic acid metabolism
    100986585 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    100986585 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100986585 (PLA2G4F)
   04010 MAPK signaling pathway
    100986585 (PLA2G4F)
   04370 VEGF signaling pathway
    100986585 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    100986585 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100986585 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100986585 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    100986585 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    100986585 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100986585 (PLA2G4F)
   04913 Ovarian steroidogenesis
    100986585 (PLA2G4F)
   04921 Oxytocin signaling pathway
    100986585 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100986585 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    100986585 (PLA2G4F)
   04726 Serotonergic synapse
    100986585 (PLA2G4F)
   04730 Long-term depression
    100986585 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100986585 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100986585 (PLA2G4F)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100986585 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100986585
NCBI-ProteinID: XP_003805660
UniProt: A0A2R9AYX5
Position
15
AA seq 849 aa AA seqDB search
MLWALRPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPRGEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLCDGEQKFLDRRKQVVSKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYFLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTQGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMQDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFDRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGG
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgctttgggcactccggccaaggtggctggcagacaagatgctgccccttctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
ctgctgtccaaagccgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggccaacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacactccggggagatgggacagccccacggggagagtac
ggctccaggcagctccagctggcagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctcccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcggctgtgcagagtggcccc
agcgcggagctggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tgtgacggggagcagaagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctccggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcgcagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagtgtcaac
gtccgcaccaacttgagtggggaagattttgcagagtggtgcgagttcacgccctatgag
gttggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttc
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccgcaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccag
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaagacaca
cacccggacgccttccccaaccagctcacccccatgcaggactgcctgtacctggtggac
ggaggctttgccatcaactctccgttcccactggctctgctgcctcagagagcagtggac
ctcattctgtcctttgactattccttggaagccccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaggacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccattgtg
ctgcacttcccccttgttaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgtcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggactttgatcggctggtggccctcagtcga
tacaacgtcctgaacaatgtggagaccttgaagtgcgccctccagctggctctggaccgg
caccaggctcgggagagggcagggggctga

DBGET integrated database retrieval system