KEGG   Pan paniscus (bonobo): 100986618Help
Entry
100986618         CDS       T02283                                 

Definition
(RefSeq) Fanconi anemia group D2 protein
  KO
K10891  fanconi anemia group D2 protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100986618
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pps03400]
    100986618
DNA repair and recombination proteins [BR:pps03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     100986618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 MKT1_N
Motif
Other DBs
NCBI-GeneID: 100986618
NCBI-ProteinID: XP_008950009
Position
3
AA seq 886 aa AA seqDB search
MSQDAFSSFFIISLQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQ
ERANLSDEQCTQVTSLLQLVHSCSEQSPQASALYYDEFANLIQHEKLDPKALEWVGHTIC
NDFQDAFVVDSCVVPEGDFPFPVKALYGLEEYDTQDGIAINLLPLLFSQDFAKDGGPVTS
QESGQKLVSPLCLAPYFRLLRLCVERQHNGNLEEIDGLLDCPIFLTDLEPGEKLESMSAK
ERSFMCSLIFLTLNWFREIVNAFCQETSPEMKGKVLTRLKHIVELQIILEKYLAGPYSCH
TLLTVFSNYFLDCFTPFFVPQQYIEFSLERFSCLSLPRLQEFTGKEEKTSLLLHNSHAFF
RELDIEVFSILHCGLVTKFILDTEMHTEATEVVQLGPPELLFLLEDLSQKLESMLTPPIA
RRVPFLKNKGSRNIGFSHLQQRSAQEIVHCVFQLLTPMCNHLENIHNYFQCLAAENHGVV
DGPAVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQPENQNLLYSALHVLSSRLKQGEHSQ
PLEELLSQSFHYLQNFHQSIPSFQCALYLIRLLMVILEKSTASTQNKEKIASLARQFLCR
VWPSGDKEKSNISNDQLHALLCIYLEHTDSILKAIEEIAGVGVPELINSPKDASSSTFPT
LTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQIHEEKLLYWNMAVRDFSILINLIKVF
DSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKHREDVLSLLETFQLDTRLLHHLCGHS
KIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNCREAFWLGNLKNRDLQGEEIKSQNSQ
ESTADESEDDMSSQASKSKATEDGEEDEVSAGEKEQESDESYDESD
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagatgcattttcatctttcttcatcatctcattgcaggatgacatgcacttg
gtgataagaaagcagctctctagcaccgtattcaagtacaagctcattgggattattggt
gctgtgaccatggctggcatcatggcggcagacagaagtgaatcacctagtttgacccaa
gagagagccaacctgagcgatgagcagtgcacacaggtgacctccttgttgcagttggtt
cattcctgcagtgagcagtctcctcaggcctctgcactttactatgatgaatttgccaac
ctgatccaacatgaaaagctggatccaaaagccctggaatgggttgggcataccatctgt
aatgatttccaggatgccttcgtagtggactcctgtgttgttccggaaggtgactttcca
tttcctgtgaaagcactgtacggactggaagaatacgacactcaggatgggatcgccata
aacctcctgccgctgctgttttctcaggactttgcaaaagatgggggtccggtgacttca
caggaatcaggccaaaaattggtgtctccgctgtgcctggctccgtatttccggttactg
agactttgtgtggagagacagcataacggaaacttggaggagattgatggtctactagat
tgtcctatattcctaactgacctggagcctggagagaagttggagtccatgtctgctaaa
gagcgttcattcatgtgttctctcatatttcttactctcaactggttccgagagattgta
aatgccttctgccaggaaacatcacctgagatgaaggggaaggtgctcactcggttaaag
cacattgtagaattgcaaataatcctggaaaagtacttggcaggtccttattcctgccac
acactgttgactgttttttctaattattttcttgactgttttactcccttttttgtaccc
cagcagtacattgaattctctcttgagcgattctcctgcctcagcctcccacgattacag
gagttcacagggaaggaagaaaagacatcattgttactacataattcccatgcttttttc
cgagagctggacattgaggtcttctctattctacattgtggacttgtgacgaagttcatc
ttagatactgaaatgcacactgaagctacagaagttgtgcaacttgggccccctgagctg
cttttcttgctggaagatctctcccagaagctggagagtatgctgacacctcctattgcc
aggagagtcccctttctcaagaacaaaggaagccggaatattggattctcacatctccaa
cagagatctgcccaagaaattgttcattgtgtttttcaactgctgaccccaatgtgtaac
cacctggagaacattcacaactattttcagtgtttagctgctgagaatcacggtgtagtt
gatggaccagcagtgaaagttcaggagtaccacataatgtcttcctgctatcagaggctg
ctgcagatttttcatggactttttgcttggagtggattttctcaacctgaaaatcagaat
ttactgtattcagccctccatgtccttagtagccgactgaaacagggagaacacagccag
cctttggaggaactactcagccagagcttccattacttgcagaatttccatcaaagcatt
cccagtttccagtgtgctctttatctcatcagacttttgatggttattttggagaaatcg
acagcttctactcagaacaaagaaaaaattgcttcccttgccagacaattcctctgtcgg
gtgtggccaagtggggataaagagaagagcaacatctctaatgaccagctccatgctttg
ctctgtatctacctggagcacacagacagcattctgaaggccatagaggagattgctggc
gttggtgtcccagaactgatcaactctcctaaagatgcatcttcctccacattccctaca
ctgaccaggcacacttttgttgttttcttccgtgtgatgatggctgaactagagaagacg
gtgaaaaaaattgagcctggcacagcagccgactcgcagcagattcatgaagagaaactc
ctctactggaacatggctgttcgagacttcagtatcctcatcaacttgataaaggtattt
gatagtcatcctgttctgcatgtatgtttgaagtatgggcgtctctttgtggaagcattt
ctgaagcaatgtatgccgctcctagacttcagttttagaaaacaccgggaagatgttctg
agcttactggaaaccttccagttggacacaaggctgcttcatcacctgtgtgggcattcc
aagattcaccaggacacgagactcacccaacatgtgcctctgctcaaaaagaccctggaa
ctgttagtttgcagagtcaaagctatgctcaccctcaacaattgtagagaggctttctgg
ctgggcaatctaaaaaaccgggacttgcagggtgaagagattaagtcccaaaattcccag
gagagcacagcagatgagagtgaggatgacatgtcatcccaggcctccaagagcaaagcc
actgaggatggtgaagaagacgaagtaagtgctggagaaaaggagcaagaaagtgatgag
agttatgatgagtctgattag

DBGET integrated database retrieval system