KEGG   Pan paniscus (bonobo): 100986658
Entry
100986658         CDS       T02283                                 

Gene name
GHSR
Definition
(RefSeq) growth hormone secretagogue receptor
  KO
K04284  growth hormone secretagogue receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100986658 (GHSR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100986658 (GHSR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100986658 (GHSR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100986658 (GHSR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Ghrelin
    100986658 (GHSR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100986658
NCBI-ProteinID: XP_003831989
UniProt: A0A2R9A7D2
Position
3
AA seq 366 aa
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtggaacgcgacgcccagcgaagagccggggttcaacctcacactggccgacctggac
tgggatgcttcccccggcaacgactcgctgggcgacgagctgctgcagctcttccccgcg
ccgctgctggcgggcgtcacagccacctgcgtggcactcttcgtggtgggcatcgctggc
aacctgctcaccatgctggtggtgtcgcgcttccgcgagctgcgcaccaccaccaacctc
tacctgtccagcatggccttctccgatctgctcatcttcctctgcatgcccctggacctc
gttcgcctctggcagtaccggccctggaacttcggcgacctcctctgcaaactcttccaa
ttcgtcagtgagagctgcacctacgccacggtgctcaccatcacagcgctgagcgtcgag
cgctacttcgccatctgcttcccactgcgggccaaggtggtggtcaccaaggggcgggtg
aagctggtcatcttcgtcatctgggccgtggccttctgcagcgccgggcccatcttcgtg
ctagtcggggtggagcacgagaacggcaccgacccttgggacaccaacgagtgccgcccc
accgagtttgcggtgcgctctggactgctcacggtcatggtgtgggtgtccagcatcttc
ttcttccttcctgtcttctgtctcactgtcctctacagtctcatcggcaggaagctgtgg
cggaggaggcgcggcgatgctgtcgtgggtgcctcgctcagggaccagaaccacaagcaa
accgtgaaaatgctggctgtagtggtgtttgccttcatcctctgctggctccccttccac
gtagggcgatatttattttcaaaatcctttgagcctggctccttggagattgctcagatc
agccagtactgcaacctcgtgtcctttgtcctcttctacctcagcgctgccatcaacccc
attctgtacaacatcatgtccaagaagtaccgggtggcagtgttcagacttctgggattt
gaacccttctcccagagaaagctctccactctgaaagatgaaagttctcgggcctggaca
gaatctagtattaatacatga

DBGET integrated database retrieval system