KEGG   Pan paniscus (bonobo): 100986683
Entry
100986683         CDS       T02283                                 

Gene name
RIPK2
Definition
(RefSeq) receptor interacting serine/threonine kinase 2
  KO
K08846  receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04621  NOD-like receptor signaling pathway
pps04722  Neurotrophin signaling pathway
pps05132  Salmonella infection
pps05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100986683 (RIPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100986683 (RIPK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100986683 (RIPK2)
   05152 Tuberculosis
    100986683 (RIPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100986683 (RIPK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100986683 (RIPK2)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   100986683 (RIPK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase CARD Kdo
Other DBs
NCBI-GeneID: 100986683
NCBI-ProteinID: XP_003821196
UniProt: A0A2R9CNU8
Position
8
AA seq 539 aa
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTLEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAQDNDFSSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINP
LSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKP
TRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLHLLQNKSM
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgaacggggaggccatctgcagcgccctgcccaccattccctaccacaaactcgccgac
ctgcgctacctgagccgcggcgcctctggcactgtgtcgtccgcccgccacgcagactgg
cgcgtccaggtggccgtgaagcacctgcacatccacactccgctgctcgacagtgaaaga
aaggatgtcttaagagaagctgaaattttacacaaagctagatttagttacattcttcca
attttgggaatttgcaatgagcctgaatttttgggaatagttactgaatacatgccaaat
ggatcattaaatgaactcctacataggaaaactgaatatcctgatgttgcttggccattg
agatttcgcatcctgcatgaaattgcccttggtgtaaattacctgcacaatatgactcct
cctttacttcatcatgacttgaagactcagaatatcttactggacaatgaatttcatgtt
aagattgcagattttggtttatcaaaatggcgcatgatgtccctctcacagtcacgaagt
agcaagtctgcaccagaaggagggacaattatctatatgccacctgaaaactatgaacct
ggacaaaaatcaagggccagtatcaagcacgatatatatagctatgcagttatcacatgg
gaagtgttatccagaaaacagccttttgaagatgtcaccaatcctttgcagataatgtat
agtgtgtcacaaggacatcgacctgttattaatgaagaaagtttgccatatgatatacct
caccgagcacgtatgatctctctaatagaaagtggatgggcacaaaatccagatgaaaga
ccatctttcttaaaatgtttaatagaacttgaaccagttttgagaacacttgaagagata
acttttcttgaagctgttattcagctaaagaaaacaaagttacagagtgtttcaagtgcc
attcacctatgtgacaagaagaaaatggaattatctctgaacatacctgtaaatcatggt
ccacaagaggaatcatgtggatcctctcagctccatgaaaatagtggttctcctgaaact
tcaaggtccctgccagctcaagacaatgatttttcatctagaaaagctcaagactgttat
tttatgaagctgcatcactgtcctggaaatcacagttgggatagcaccatttctggatct
caaagggctgcattctgtgatcacaagaccactccatgctcttcagcaataataaatcca
ctctcaactgcaggaaactcagaacgtctgcagcctggtatagcccagcagtggatccag
agcaaaagggaagacattgtgaaccaaatgacagaagcctgccttaaccagtcgctagat
gcccttctgtccagggacttgatcatgaaagaggactatgaacttgttagtaccaagcct
acaaggacctcaaaagtcagacaattactagacactactgacatccaaggagaagaattt
gccaaagttatagtacaaaaattgaaagataacaaacaaatgggtcttcagccttacccg
gaaatacttgtggtttctagatcaccatctttacatttacttcaaaataaaagcatgtaa

DBGET integrated database retrieval system