KEGG   Pan paniscus (bonobo): 100986960
Entry
100986960         CDS       T02283                                 

Gene name
SRD5A2
Definition
(RefSeq) steroid 5 alpha-reductase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00140  Steroid hormone biosynthesis
pps05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100986960 (SRD5A2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100986960 (SRD5A2)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100986960 (SRD5A2)
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 100986960
NCBI-ProteinID: XP_003827211
UniProt: A0A2R9ANP5
Position
2A
AA seq 254 aa
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAILILRGIAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcaggttcagtgccagcagagcccagtgctggcaggcagcgccactttggtcgccctt
ggggcactggccttgtacgtcgcgaagccctccggctacgggaagcacacggagagcttg
aagccggcggctacccgcctgccagcccgcgccgcctggttcctgcaggagctgccttcc
ttcgcggtgcccgcggggatcctcgcccggcagcccctctccctcttcgggccacctggg
acggtacttctgggcctcttctgcgtacattacttccacaggacatttgtgtactcactg
ctcaatcgagggaggccttatccagctatactcattctcagaggcattgccttctgcact
ggaaatggagtccttcaaggctactatctgatttactgtgctgaataccctgatgggtgg
tacacagacatacggtttagcttgggtgtcttcttatttattttgggaatgggaataaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcatttgcatttttctca
ctttgtttccttgggctgcgagcttttcaccaccataggttctacctcaagatgtttgag
gactaccccaaatctcggaaagcccttattccattcatcttttaa

DBGET integrated database retrieval system