KEGG   Pan paniscus (bonobo): 100986982
Entry
100986982         CDS       T02283                                 

Definition
(RefSeq) killer cell immunoglobulin-like receptor 2DL5A
  KO
K24232  killer cell immunoglobulin-like receptor 2DL5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04612  Antigen processing and presentation
pps04650  Natural killer cell mediated cytotoxicity
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100986982
   04612 Antigen processing and presentation
    100986982
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    100986982
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100986982
CD molecules [BR:pps04090]
 Proteins
  100986982
SSDB
Motif
Pfam: ig Ig_2 Ig_3 V-set Tweety SIT
Other DBs
NCBI-GeneID: 100986982
NCBI-ProteinID: XP_003830222
Position
19
AA seq 342 aa
MSLMVISMACVGFFLLQGSWPHMGGQDKPLLSAWPSPVVPRGGHVTLLCRSRLGFTIFSL
YKEDGLPVPELYNKIFWKSILMDPVTPAHAGTYRCRGSHPHSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVHAGENVTLSCSSRSSFDMYHLSREGRVHEPRLPAVPSINGTFQADF
PLGPATHGGTYTCFGSFHDSPYEWSDPSHPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFLLHRCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQL
DHCVFTQTKITAPSQRPKTPPTDTTMYMELPNAKPRXIVSCP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgggttcttcttgctgcaggggtcctgg
ccacacatgggtggacaggacaagcccttgctgtctgcctggcccagccctgtggtgcct
cgaggaggacatgtgactcttctgtgtcgctctcgtcttgggtttaccatcttcagtctg
tacaaagaagatgggctgcctgtccctgagctctacaacaaaatattctggaagagcatc
ctcatggaccctgtgacccctgcacacgcagggacctacagatgtcggggttcacacccg
cactcccccattgagtggtcggcacccagcaaccccctggtgatcgtggtcacaggtcta
tttgggaaaccttcgctctcagcccagccgggccccacggttcacgcaggagagaacgtg
accttgtcctgcagctccaggagctcatttgacatgtaccatctatccagggaggggagg
gtccatgaacctaggctccctgcagtgcccagcatcaatggaacattccaggctgacttt
cctctgggccctgccacccacggagggacctacacatgcttcggctctttccatgactca
ccctatgagtggtcagacccgagtcacccactgcttgtttctgtcacaggaaactcttca
agtagttcatcttcacccactgaaccaagctccaaaactggtatccgcagacacctgcac
attctgattgggacctcagtggctatcatcctctttatcatcctcttctttctccttcat
cgctgctgctccaacaaaaagaatgctgctgtaatggaccaagagcctgccggggacaga
acagtgaacagggaggactctgatgatcaagaccctcaggaggtgacatatgcacagttg
gatcactgcgttttcacacagacaaaaatcactgccccttctcagaggcccaagacacct
ccaacagataccaccatgtacatggaacttccaaatgctaagccaagantcattgtctcc
tgcccatga

KEGG   Pan paniscus (bonobo): 100987319
Entry
100987319         CDS       T02283                                 

Gene name
KIR2DL1
Definition
(RefSeq) killer cell immunoglobulin-like receptor 2DL3
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04612  Antigen processing and presentation
pps04650  Natural killer cell mediated cytotoxicity
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100987319 (KIR2DL1)
   04612 Antigen processing and presentation
    100987319 (KIR2DL1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    100987319 (KIR2DL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100987319 (KIR2DL1)
CD molecules [BR:pps04090]
 Proteins
  100987319 (KIR2DL1)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 V-set SIT
Other DBs
NCBI-GeneID: 100987319
NCBI-ProteinID: XP_008953855
Position
19
AA seq 575 aa
MSLMAVSMACVGFFLLQGAWPHEGGQNKPLMSAWPSLVVPLGHVILRCHSYLGFNNFSLY
KEGGVPVPELYNRILWNSLFMGPVTPAHTGTYRCRGSHPHSPSGWPASSNPLVIVVTAVH
RKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGKFNDTLRLTGELHDGVSKANFS
ISRMTLDLAGTYRCYGSVTHSPYLLSAPSDPLDIVITGVHRKPSLLALPGHLVKSEETVI
LQCWSDVMFEHFLLHREGKVEDTLRLIGELHDGVFKANFSIGPMTHVLAGTYRCYGSVPH
FRYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEA
HEHRLPAVTKVNGTFQADFPLGPATQGGTYRCFGSFRVSPYEWSNSSDPLLVSVTENPSN
SWPSPTEPSSKTGNPRHLHVLIGTSVVIILLILLLFFLLHRWCSNKKNAAVMDQEPAGNR
TVNREDSDEQDPQEVTYAQLDHCVFTQRKITRLSQRPKTPPTDTIVYTELPNAEPRSNVS
PAHEHHSQALRGSSRETTALSLNWVASSHVPAAGI
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtcgctcatggccgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggtggtcagaacaagcccttgatgtctgcctggcccagccttgtggtgcct
ctaggacatgtcattcttcggtgtcactcttatcttgggtttaacaacttcagtctgtac
aaggaaggtggggtgcctgtccctgagctctacaacagaatactctggaacagccttttc
atgggccctgtgaccccagcacacacagggacatacagatgtcggggttcacacccacac
tcccccagtgggtggccggcatccagcaaccccctggtgatcgtggtcacagcagtccac
aggaaaccttccctcctggcccaccctggtcccctggtgaaatcagaagagacagtcatc
ctgcaatgttggtcggatgtcatgtttgagcacttccttctgcacagagaggggaagttt
aacgacactttgcgcctcactggagagctccatgatggggtctccaaggccaacttctcc
atcagtcgcatgacgctagacctggcagggacctacagatgctacggttctgttactcac
tccccctatctgttgtcagctcccagtgaccctctggacatcgtgatcacaggagtccac
agaaaaccttccctcctggccctcccaggtcacctggtgaaatcagaagagacagtcatc
ctgcaatgttggtcagatgtcatgtttgagcacttccttctgcacagagaggggaaggtt
gaggacactttgcgcctcattggagagctccatgatggggtcttcaaggccaacttctcc
atcggtcccatgacgcatgtccttgcagggacctacagatgctacggttctgttcctcac
ttccgctatcagttgtcagctcccagtgaccctctggacatcgtgatcacaggtctatat
gagaaaccttctctctcagcccagccgggccccacggttctggcaggagagaatgtgacc
ttgtcctgcagctcccggagctcctatgacatgtaccatctatccagggagggggaggcc
catgaacataggctccctgcagtgaccaaggtcaacggaacattccaggctgactttccg
ctgggccctgccacccagggagggacctacagatgcttcggctctttccgtgtatctccc
tacgagtggtcaaactcgagtgacccactgcttgtttctgtcacagaaaacccttcaaat
agttggccttcacccactgaaccaagctccaaaaccggtaaccccagacacctgcacgtt
ctgattgggacctcagtggtcatcatcctcctcatcctcctcctcttctttctccttcat
cgctggtgctccaacaaaaaaaatgctgctgtaatggaccaagagcctgcagggaacaga
acagtgaacagggaggattctgatgaacaagaccctcaggaggtgacatatgcacagttg
gatcactgcgttttcacacagagaaaaatcactcgcctttctcagaggcccaagacaccc
ccaacagataccatcgtgtacacggaacttccaaatgctgagcccagatccaatgtttct
cctgcccatgagcaccacagtcaggccttgaggggatcttctagggagacaacagccctg
tctctaaactgggttgccagctcccatgtaccagcagctggaatctga

KEGG   Pan paniscus (bonobo): 100990924
Entry
100990924         CDS       T02283                                 

Gene name
KLRC1
Definition
(RefSeq) killer cell lectin like receptor C1
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04612  Antigen processing and presentation
pps04650  Natural killer cell mediated cytotoxicity
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100990924 (KLRC1)
   04612 Antigen processing and presentation
    100990924 (KLRC1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    100990924 (KLRC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100990924 (KLRC1)
   04091 Lectins [BR:pps04091]
    100990924 (KLRC1)
CD molecules [BR:pps04090]
 Proteins
  100990924 (KLRC1)
Lectins [BR:pps04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   100990924 (KLRC1)
SSDB
Motif
Pfam: UL45 Lectin_C Chordopox_A33R
Other DBs
NCBI-GeneID: 100990924
NCBI-ProteinID: XP_003829672
UniProt: A0A2R8ZLF0
Position
12
AA seq 233 aa
MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQENDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
EEWITYSNSCYYIGKERRTWEESLLACTSKNSGLLSIDNEEEMKFLSIISPSSWIGVFRN
SSHHPWVTINGLAFKHEIKDSDNAELNCAVLQVNGLKSAQCGSSIIYHCKHKL
NT seq 702 nt   +upstreamnt  +downstreamnt
atggataaccaaggagtaatctactcagacctgaatctgcccccaaacccaaaaaggcag
caacgaaaacctaaaggcaataaaagctccattttagcaactgaacaggaaataacctat
gcggaattaaaccttcaaaaagcttctcaggattttcaagagaatgacaaaacctatcac
tgcaaagatttaccatcagctccagagaagctcattgttgggatcctgggaattatctgt
cttatcttaatggcctctgtggtaacgatagttgttattccctctacattaatacagagg
cacaacaattcttccctgaatacaagaactcagaaagcacgtcattgtggccattgtcct
gaggagtggattacatattccaacagttgttattacattggtaaggaaagaagaacttgg
gaagagagtttgctggcctgtacttcaaagaactccggtctgctttctatagataatgaa
gaagaaatgaaatttctgtccatcatttcaccatcctcatggattggtgtgtttcgtaac
agcagtcatcatccatgggtgacaataaatggtttggctttcaaacatgagataaaagac
tcagataatgctgaacttaactgtgcagtgctacaagtaaatggacttaaatcagcccag
tgtggatcttcaataatatatcattgtaagcataagctttag

KEGG   Pan paniscus (bonobo): 100992162
Entry
100992162         CDS       T02283                                 

Gene name
KLRD1
Definition
(RefSeq) killer cell lectin like receptor D1
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04612  Antigen processing and presentation
pps04650  Natural killer cell mediated cytotoxicity
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100992162 (KLRD1)
   04612 Antigen processing and presentation
    100992162 (KLRD1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    100992162 (KLRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100992162 (KLRD1)
   04091 Lectins [BR:pps04091]
    100992162 (KLRD1)
CD molecules [BR:pps04090]
 Proteins
  100992162 (KLRD1)
Lectins [BR:pps04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   100992162 (KLRD1)
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R Ly49
Other DBs
NCBI-GeneID: 100992162
NCBI-ProteinID: XP_003829677
UniProt: A0A2R9C883
Position
12
AA seq 179 aa
MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCS
CQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLS
YSEEHTAWLWENGSALSQYLFPSFETFNPKNCIAYNPNGNALDESCEDKNRYICKQQLI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcagtgtttaagaccactctgtggaggttaatttctgggaccttagggataatatgc
ctttcgttgatggctacgttgggaattttgttgaaaaattcttttactaaactgagtatt
gagccagcatttactccaggacccaacatagaactccagaaagattctgactgctgttct
tgccaagaaaaatgggttgggtaccggtgcaactgttacttcatttccagtgaacagaaa
acttggaacgaaagtaggcatctctgtgcttctcagaaatccagcctgcttcagcttcaa
aacacagatgaactggattttatgagctccagtcaacaattttactggattggactctct
tacagtgaggaacacaccgcctggttgtgggagaatggctctgcactctcccagtatcta
tttccatcatttgaaacttttaatccaaagaactgcatagcgtataatccaaatggaaat
gctttagatgaatcctgtgaagataaaaatcgttatatctgtaagcaacagctcatttaa

KEGG   Pan paniscus (bonobo): 100992623
Entry
100992623         CDS       T02283                                 

Definition
(RefSeq) putative killer cell immunoglobulin-like receptor-like protein KIR3DX1
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04612  Antigen processing and presentation
pps04650  Natural killer cell mediated cytotoxicity
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100992623
   04612 Antigen processing and presentation
    100992623
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    100992623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100992623
CD molecules [BR:pps04090]
 Proteins
  100992623
SSDB
Motif
Pfam: ig Ig_2 Ig_3 V-set IreB
Other DBs
NCBI-GeneID: 100992623
NCBI-ProteinID: XP_008953850
Position
19
AA seq 457 aa
MAPRLITVLCLGFCLNQKICPHAGAQDKFSLSAWPSPVVPLGGRVTLSCHSHLRFVIWTI
FQTTGTRSHQLHIGLSNNITISPVTPGHAGTYRCVGIYKHTSKWSAESNSLKIIVTGLFT
KPCISAHPSPLVHAGARVSLRCHSELAFDEFILYKEGHIQHSQQLDQGMEAGIHYVEAVF
SVGPVTPAHAGAYRCCGCFSHSRYEWSAPSDPLDIVITGKYKKPSLSTQVDPMMRLGEKL
TLFCSSEISFDQYRLFRDGVAHGQWLSGGQRHRGAFQANFSVGRSMPVPGGTYRCYGSFN
DSPYEWSAPSDPLQLYATGNTKITPLSFTESTPESDTHRPQGQSSNLHMLTGLSVAIISI
GVCLSAFIGFWCYIKYHTTMANTEPTEGQRTDEEEPAAEETQEIIYAQLNHQALSQTGFP
PVSQCPHYLSEEPSIYITVHQAQAEARAAPSLWHKGH
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggcccccagactcatcaccgtcctgtgtctgggattctgcctgaaccagaagatctgc
ccacatgcgggtgctcaggacaagttctccctgtcagcctggccgagccctgtggttccc
ctaggaggacgtgtgactctctcctgtcattcccatcttcggtttgtcatatggacaata
ttccaaacaactgggacccgaagccatcagttgcacattggcctttccaacaacatcacc
atcagccctgtgaccccaggacacgcagggacctacagatgtgttggaatttacaagcac
acctcgaagtggtcagctgagagcaactccctgaagatcatcgtcacaggcttgttcaca
aaaccctgcatctcagcgcacccaagccccctggtgcacgcaggagccagggtgagcctg
cgctgtcactcagagctggcctttgatgaatttatcttatacaaagaggggcacatacag
cattcccagcagcttgaccaggggatggaggctgggatccattacgtcgaggctgtcttt
tccgtgggtcctgtaacgcctgcccatgcaggagcctacaggtgctgtggttgtttcagt
cactcccgctatgagtggtcggctcccagtgaccccctggacattgtgatcacaggaaaa
tacaaaaagccttctctctccacccaggtggaccccatgatgaggctgggagagaagttg
accctcttctgcagctctgaaatctcatttgaccagtaccgtctgttcagagacggggtt
gctcatggacagtggctcagtggagggcagagacataggggagcattccaggccaacttt
tctgtgggccgctcaatgccagtccctggcgggacctatagatgctatggttccttcaat
gactctccctatgagtggtcagcccccagtgacccgctgcaactttacgccacaggaaac
actaagattactcctctgtcattcacggaatccacccctgaatctgacacacatcgccct
caaggacagtccagcaacctgcatatgctcactggactctcagtagccatcatctccatt
ggcgtttgcctctctgcttttattggtttctggtgttacataaaatatcacaccaccatg
gcaaacacagagcccacggaaggccaacggacggatgaagaagagcctgcagcagaagag
acacaggagatcatatatgcccagttaaaccaccaggccctctcacagacaggattccct
cctgtctcccagtgtccccactacctctcggaggagcccagtatctacatcactgtccac
caagcccaggctgaggccagagctgcccccagtctttggcacaaagggcattaa

KEGG   Pan paniscus (bonobo): 100994016
Entry
100994016         CDS       T02283                                 

Gene name
KIR3DL3
Definition
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04612  Antigen processing and presentation
pps04650  Natural killer cell mediated cytotoxicity
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100994016 (KIR3DL3)
   04612 Antigen processing and presentation
    100994016 (KIR3DL3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    100994016 (KIR3DL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100994016 (KIR3DL3)
CD molecules [BR:pps04090]
 Proteins
  100994016 (KIR3DL3)
SSDB
Motif
Pfam: ig Ig_2 Ig_3
Other DBs
NCBI-GeneID: 100994016
NCBI-ProteinID: XP_008953864
Position
19
AA seq 367 aa
MSLMVVSMACVGFFLLQGPWSHVGGQDKPFLSAWPSTVVSEGQHVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGV
HRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNY
SMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVIGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEARELRLTAVLRVNGTFQANFRLGPVTHGGSYRCFGSFRAL
PHVWSHPSDPLPVSVTGNRRHLHLLIGTSVVIILFILLLLFLLHRWCSNKKTLDSELLEA
EWSLICL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcatgtgttgggttcttcttgctgcaggggccctgg
tcacatgtgggtggtcaggacaagcccttcctctctgcctggcccagcactgtggtgtct
gaaggacaacatgtgactcttcagtgtcgctctcgtcttgggtttaacgaattcagtctg
tccaaagaagacgggatgcctgtccctgagctctacaacagaatattccggaacagcttt
ctcatgggccctgtgaccccagcacatgcaggaacctacagatgttgcagttcacaccca
cactcccccactgggtggtcggcacccagcaaccctgtggtgatcatggtcacaggagtc
cacagaaaaccttccctcctggcccacccaggtcccctggtgaaatcgggagagacggtc
atcctgcaatgttggtcagatgtcaggtttgagcgcttccttctgcacagagaggggatc
actgaggaccccttgcgcctcgttggacagctccacgatgcgggttcccaggtcaactac
tccatgggtcccatgacacctgcccttgcagggacctacagatgctttggttctgtcact
cacttaccctatgagttgtcggctcccagtgaccctctggacatcgtggtcataggtcta
tatgggaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaatgtg
accttgtcctgcagctcgcggagcttgtttgacatttaccatctatccagggaggcggag
gcccgtgaacttaggctcactgcagtgctgagggtcaatggaacattccaggccaacttc
cgtctgggccctgtgacccatggagggagctacagatgcttcggctctttccgtgccctg
ccccacgtgtggtcacacccgagtgacccactgcccgtttctgtcacaggtaaccgcaga
cacctgcaccttctgattgggacctcagtggtcatcatcctcttcatcctcctcctcttg
tttctccttcatcgctggtgctccaacaaaaaaaccctggactctgagcttctggaagca
gaatggagcctgatttgtctctga

KEGG   Pan paniscus (bonobo): 103784706
Entry
103784706         CDS       T02283                                 

Gene name
KIR3DL2
Definition
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04612  Antigen processing and presentation
pps04650  Natural killer cell mediated cytotoxicity
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103784706 (KIR3DL2)
   04612 Antigen processing and presentation
    103784706 (KIR3DL2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    103784706 (KIR3DL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    103784706 (KIR3DL2)
CD molecules [BR:pps04090]
 Proteins
  103784706 (KIR3DL2)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 MAP17 ASFV_J13L
Other DBs
NCBI-GeneID: 103784706
NCBI-ProteinID: XP_014198378
Position
19
AA seq 457 aa
MSLMVVSMACVGFFLLQRACPHMGGQDKPFLSARPSAMVPRGGHVTLRCHYRGGFNNFTL
YEEDRIHVPIFHGRIFQESFIMGPVTPAHAGNYTCRGSHPHSPTGWSAPSNPLVIMVTGV
HRKPSLLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKVEDTLRLIGELHDGVFKANF
SIGPMTHVLAGTYRCYGSVPHFRYQLSAPSDPLDIVITGLYEKRSLSAQLGPTVLAGENV
TLSCSSRSSYDMYHLFREGEAHERELRLPAVRSVNGTLQADFPLGPATHGGTYRCFGSFP
HSPYEWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGIRRHLHVLIGTSVVIILFIIILFF
LLHRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKIGRPSQRP
KTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagagggcctgt
ccacacatgggtggtcaggacaagcccttcctgtctgcccggcccagtgctatggtgcct
cgaggaggacacgtgactcttcggtgtcactatcgtggtgggtttaacaatttcacgctg
tacgaagaagacagaatccacgttcccatcttccacggcagaatattccaggagagcttc
atcatgggccctgtgaccccagcacatgcagggaactacacatgtcggggttcacaccca
cactcccccactgggtggtcagcacccagcaaccccctggtgatcatggtcacaggagtc
cacagaaaaccttccctcctggccctcccaggtcacctggtgaaatcagaagagacagtc
atcctgcaatgttggtcagatgtcatgtttgagcacttccttctgcacagagaggggaag
gttgaggacactttgcgcctcattggagagctccatgatggggtcttcaaggccaacttc
tccatcggtcccatgacgcatgtccttgcagggacctacagatgctacggttctgttcct
cacttccgctatcagttgtcagctcccagtgaccctctggacatcgtgatcacaggtcta
tatgagaaacgttctctctcagcccagctgggccccacggttctggcaggagagaacgtg
accttgtcctgcagctcccggagctcctatgacatgtaccatctattcagggagggggag
gcccatgaacgtgaacttaggctccctgcagtgcgcagcgtcaatggaacactccaggcc
gacttccctctgggccctgccacccatggagggacctacagatgcttcggctctttccct
cactctccctacgagtggtcaaactcgagtgacccactgcttgtttctgtcacaggaaac
ccttcaagtagttggccttcacccacagaaccaagctccaaatctggtatccgcagacac
ctgcacgttctgattgggacctcagtggtcatcatcctcttcatcatcatcctcttcttt
ctccttcatcgctggtgctccaacaaaaagaatgctgctgtaatggaccaagagcctgcg
ggggacagaacagtgaataggcaggactctgatgaacaagaccctcaggaggtgacatac
gcacagttggatcactgcgttttcatacagagaaaaatcggtcgcccttctcagaggccc
aagacacccctaacagataccagcgtgtacacggaacttccaaatgctgagcccagatcc
aaagttgtctcctgcccacgagcaccacagtcaggacttgagggggttttctag

DBGET integrated database retrieval system