KEGG   Pan paniscus (bonobo): 100987153
Entry
100987153         CDS       T02283                                 

Gene name
GZMB
Definition
(RefSeq) granzyme B
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04210  Apoptosis
pps04650  Natural killer cell mediated cytotoxicity
pps04940  Type I diabetes mellitus
pps05202  Transcriptional misregulation in cancer
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100987153 (GZMB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100987153 (GZMB)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100987153 (GZMB)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100987153 (GZMB)
   05330 Allograft rejection
    100987153 (GZMB)
   05332 Graft-versus-host disease
    100987153 (GZMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100987153 (GZMB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100987153 (GZMB)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     100987153 (GZMB)
Peptidases and inhibitors [BR:pps01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100987153 (GZMB)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 100987153
NCBI-ProteinID: XP_003809164
UniProt: A0A2R9C548
Position
14
AA seq 281 aa
MKSLSLLHLFPLPRAKREQGGNNSSSNQGSLPEKMQPILLLLAFLLLPRADAGEIIGGHE
AKPHSRPYMAYLMIWDQKTLKRCGGFLIREDFVLTAAHCWGSSINVTLGAHNIKEQEPTQ
QFIPVKRPIPHPAYNPKNYSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQACSVAG
WGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGP
LVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaagtcactgagcctgctccacctctttcctctaccaagagctaaaagagagcaagga
ggaaacaacagcagctccaaccagggcagccttcctgagaagatgcaaccaatcctgctt
ctgctggccttcctcctgctgcccagggcagatgcaggggagatcatcggcggacatgag
gccaagccccactcccgcccctacatggcttatcttatgatctgggatcagaagactctg
aagaggtgcggtggcttcctgatacgagaggacttcgtgctgacagctgctcactgttgg
ggaagctccataaatgtcaccttgggggcccacaatatcaaggaacaggagccgacccag
cagtttatccctgtgaaaagacccatcccccatccagcctataatcctaagaactactcc
aacgacatcatgctactgcagctggagagaaaggccaagcggaccagagctgtgcagccc
ctcaggctacctagcaacaaggcccaggtgaagccagggcaggcgtgcagtgtggccggc
tgggggcagacggcccccctgggaaaacactcacacacactacaagaggtgaagatgaca
gtgcaggaagatcgaaagtgcgaatctgacttacgccattattacgacagtaccattgag
ttgtgcgtgggggacccagagattaaaaagacttcctttaagggggactctggaggccct
cttgtgtgtaacaaggtggcccagggcattgtctcctatggacgaaacaatggcatgcct
ccacgagcctgcaccaaagtctcaagctttgtacactggataaagaaaaccatgaaacgc
cactaa

DBGET integrated database retrieval system