KEGG   Pan paniscus (bonobo): 100987203
Entry
100987203         CDS       T02283                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100987203 (AKAP5)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100987203 (AKAP5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 100987203
NCBI-ProteinID: XP_003831662
UniProt: A0A2R8ZNQ9
Position
14
AA seq 427 aa
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQ
DVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTENV
AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPK
QFLISTENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLE
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacaatttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgaaaggcagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagccaaagcactgaagcccaaagctggctctgaagctgctgatgtggcaagg
aagtgtccacaagaagcaggagcttctgatcagccagagcccacacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagcca
ttggagggtgaaatgcaacctgcaataaatgctgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaggtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagataatgggcat
tctgctattcaaacgggaactctaatccttgaagaaattgaaacgatcaaggaaaaacaa
gatgttcaaccccagcaagcaagcccacttgaaacttcagaaacagaccatcagcagcca
gtactttctgatgttcctcctttacctgcaattccagatcaacaaattgtggaagaagcc
agtaacagtaccctagaaagtgcaccaaatggaaaagactatgaaagtacagagaatgta
gctgaagaaactaagccaaaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaaatccaaatcagaagaaagcaaaagaatggagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttacaaaatctaaaaatgtccctaag
caattcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctcttgtc
aagaatgctattcagttgtcaatagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctagagtga

DBGET integrated database retrieval system