KEGG   Pan paniscus (bonobo): 100987708
Entry
100987708         CDS       T02283                                 

Gene name
PIGR
Definition
(RefSeq) polymeric immunoglobulin receptor
  KO
K13073  polymeric immunoglobulin receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100987708 (PIGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100987708 (PIGR)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100987708 (PIGR)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 100987708
NCBI-ProteinID: XP_003822957
UniProt: A0A2R9B7M7
Position
1
AA seq 764 aa
MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGA
RGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLS
FDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSN
DYVNPNYTGRIHLDIQGTGQLVFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKP
EPELVYEDLRGSVTFHCALGLEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLN
PQDKDGSFSVVITGLRKEDAGRYLCGAHLDGELQEGSPIQAWQLFVNEESTIPRSPTVVK
GVAGGSVAVLCPYNPKESKSIKYWCLWEGAQNGRCPLLVESEGRVKEQYEGRLSLLEEPG
NGTFTVILNQLTSRDAGFYWCLTNGDTRWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKV
PCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNPVTRADEG
WYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGVREIENKAIQ
DPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSRALVSTLVPLGLVLAVGAVAVGV
ARARHRKNVDRVSIRSYRTDISMSDFENSREFGANDNMGASSITQETSLGGKDEFVATTE
STTETKEPKKAKRSSKEEAEMAYKDFLLQSSTVAAEAQDGPQEA
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgctgctcttcgtgctcacctgcctgctggcggtcttcccagccatctccacgaagagt
cccatatttggtcctgaggaggtgaatagtgtggaaggtaactcagtgtccatcacgtgc
tactacccacccacctctgtcaaccggcacacccggaagtactggtgccggcagggagct
agaggtggctgcataaccctcatctcctcggagggctacgtctccagcaaatatgcaggc
agggctaacctcaccaacttcccggagaacggcacatttgtggtgaacattgcccagctg
agccaggatgactccgggcgctacaagtgtggcctgggcatcaatagccgaggcctgtcc
tttgatgtcagcctggaggtcagccagggtcctgggctcctaaatgacactaaagtctac
acagtggacctgggcagaacggtgaccatcaactgccctttcaagactgagaatgctcaa
aagaggaagtccttgtacaagcagataggcctgtaccctgtgctggtcatcgactccaat
gattatgtgaatcccaactatacaggaagaatacaccttgatattcagggtactggccag
ttagtgttcagcgttgtcatcaaccaactcaggctcagcgatgctgggcagtatctctgc
caggctggggatgattccaatagtaataagaagaatgctgacctccaagtgctaaagccc
gagcccgagctggtttacgaagacctgaggggctcagtgaccttccactgtgccctgggc
cttgaggtggcaaacgtggccaaatttctgtgccgacagagcagtggggaaaactgtgat
gtggtcgtcaacaccctggggaagagggccccagcctttgagggcaggatcctgctcaac
ccccaggacaaggatggctcattcagtgtggtgatcacaggcctgaggaaggaggatgca
gggcgctacctgtgtggagcccatttggatggtgagctacaggaaggctcgcccatccag
gcctggcaactcttcgtcaatgaggagtccacgattccccgcagccccactgtggtgaag
ggggtggcaggaggctctgtggccgtgctctgcccctacaaccctaaggaaagcaaaagc
atcaagtactggtgtctctgggaaggggcccagaatggccgctgccccctgctggtggag
agcgaggggcgggttaaggagcagtacgagggccgcctctccctgctggaggagccaggc
aacggcaccttcactgtcatcctcaaccagctcaccagccgggacgccggcttctactgg
tgtctgaccaacggcgatactcgctggaggaccaccgtggagatcaagattatcgaagga
gaaccaaacctcaaggtaccagggaatgtcacggctgtgctgggagagactctcaaggtc
ccctgtcacttcccatgcaaattctcctcgtacgagaaatactggtgcaagtggaataac
acgggctgccaggccctgcccagccaagatgaaggccccagcaaggccttcgtgaactgt
gacgagaacagccggcttgtctccctgaccctgaacccggtgaccagggctgatgagggc
tggtactggtgtggagtgaagcagggccacttctatggagagactgcagccgtctatgtg
gcagttgaagagaggaaggcagcggggtcccgcgatgtcagcctagcgaaggcagacgct
gctcctgatgagaaggtgctagactctggtgttcgggagattgagaacaaagccattcag
gatcccaggctttttgcagaggaaaaggcggtggcagatacaagagatcaagccgatggg
agcagagcatctgtggattccggcagctctgaggaacaaggtggaagctccagagcgctg
gtctccaccctggtgcccctgggcctggtgctggcagtgggagccgtggctgtgggggtg
gccagagcccggcacaggaagaacgtcgaccgagtttcaatcagaagctacaggacagac
attagcatgtcagacttcgagaactccagggaatttggagccaatgacaacatgggagcc
tcttcgatcactcaggagacatccctcggaggaaaagatgagtttgttgccaccactgag
agcaccacggagaccaaagaacccaagaaggcaaaaaggtcatccaaggaggaagccgag
atggcctacaaagacttcctgctccagtccagcaccgtggccgccgaggcccaggacggc
ccccaggaagcctag

DBGET integrated database retrieval system