KEGG   Pan paniscus (bonobo): 100987753Help
Entry
100987753         CDS       T02283                                 

Gene name
CABP4
Definition
(RefSeq) calcium binding protein 4
  KO
K23531  calcium-binding protein 1/2/4/5
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100987753 (CABP4)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    100987753 (CABP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 SPARC_Ca_bdg EF-hand_4 DIMCO_N DUF5580
Motif
Other DBs
NCBI-GeneID: 100987753
NCBI-ProteinID: XP_003828772
UniProt: A0A2R9AG42
Position
11
AA seq 275 aa AA seqDB search
MTTEQARGQQGPNLAIGRQKPPAGVVTPKSDAEEPPLTRKRSKKERGLRGSRKRTGSSGE
QTGPEAPGSSNNPPSTGEGPAGAPPASPGPASSRQSHRHRPDSRHDAAQRTYGPLLNRVF
GKDRELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMR
MGGRVDFEEFVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLG
EPLAGPELDEMLREVDLNGDGTVDFDEFVMMLSRH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagagcaggcaagggggcagcagggcccaaatctggccattggccgtcagaag
ccccctgcgggggttgtgactcccaagagtgatgcagaggagcccccgttgaccaggaag
aggagcaagaaggagagggggctccgagggtctcgaaagcgcactggcagctctggggag
cagacaggccccgaggccccggggagcagcaataaccctcccagcactggagaggggccg
gcgggcgcaccccctgcatcccctgggccggcctcttctcgccagtcccaccgacatcgt
cctgactcccggcacgacgctgctcagaggacatacgggcccctgctcaatcgagtcttc
gggaaggaccgcgagttgggccccgaggagctagacgagcttcaggccgccttcgaggag
tttgacactgaccgtgacggctacatcagccaccgggagctgggtgactgcatgcggacc
ctgggctacatgcccaccgagatggagctcctggaggtctcgcagcacatcaagatgcgc
atgggcggccgtgtggactttgaggagtttgtagaactgataggcccaaagctgagggag
gagacggcacacatgctgggggtgcgagagctgcgcatcgccttccgagagtttgacagg
gacagggatggacgaattacggtggcggagctgcgggaggcggtaccggctctgctcggg
gagccgctggcgggtcctgagctggacgagatgctccgagaagtggacctcaatggggat
ggcaccgtagactttgacgagtttgtgatgatgctctcccgccactga

DBGET integrated database retrieval system