KEGG   Pan paniscus (bonobo): 100987957
Entry
100987957         CDS       T02283                                 

Gene name
FOS
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04024  cAMP signaling pathway
pps04210  Apoptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04668  TNF signaling pathway
pps04713  Circadian entrainment
pps04725  Cholinergic synapse
pps04728  Dopaminergic synapse
pps04915  Estrogen signaling pathway
pps04917  Prolactin signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04932  Non-alcoholic fatty liver disease
pps04935  Growth hormone synthesis, secretion and action
pps05031  Amphetamine addiction
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05161  Hepatitis B
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05224  Breast cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100987957 (FOS)
   04668 TNF signaling pathway
    100987957 (FOS)
   04024 cAMP signaling pathway
    100987957 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100987957 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100987957 (FOS)
   04660 T cell receptor signaling pathway
    100987957 (FOS)
   04658 Th1 and Th2 cell differentiation
    100987957 (FOS)
   04659 Th17 cell differentiation
    100987957 (FOS)
   04657 IL-17 signaling pathway
    100987957 (FOS)
   04662 B cell receptor signaling pathway
    100987957 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100987957 (FOS)
   04917 Prolactin signaling pathway
    100987957 (FOS)
   04921 Oxytocin signaling pathway
    100987957 (FOS)
   04926 Relaxin signaling pathway
    100987957 (FOS)
   04935 Growth hormone synthesis, secretion and action
    100987957 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100987957 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100987957 (FOS)
   04728 Dopaminergic synapse
    100987957 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100987957 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100987957 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100987957 (FOS)
   05231 Choline metabolism in cancer
    100987957 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100987957 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100987957 (FOS)
   05224 Breast cancer
    100987957 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100987957 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100987957 (FOS)
   05161 Hepatitis B
    100987957 (FOS)
   05171 Coronavirus disease - COVID-19
    100987957 (FOS)
   05162 Measles
    100987957 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100987957 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100987957 (FOS)
   05135 Yersinia infection
    100987957 (FOS)
   05133 Pertussis
    100987957 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100987957 (FOS)
   05142 Chagas disease
    100987957 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100987957 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100987957 (FOS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100987957 (FOS)
   05418 Fluid shear stress and atherosclerosis
    100987957 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100987957 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100987957 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100987957 (FOS)
   04131 Membrane trafficking [BR:pps04131]
    100987957 (FOS)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100987957 (FOS)
Membrane trafficking [BR:pps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100987957 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 100987957
NCBI-ProteinID: XP_003824232
UniProt: A0A2R8ZK96
Position
14
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg
tccccggccggggatagcctctcttactaccactcacccgcagactccttctccagcatg
ggttcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcccgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccacc
ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg
cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggttgccaccccggagtctgaagaggccttcacc
ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcattagc
agcatggagctgaagaccgagccctttgatgacttcctgttcccagcatcatccaggccc
agtggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcctctgcacagtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcagctgcccaccgcaag
ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system