KEGG   Pan paniscus (bonobo): 100987986Help
Entry
100987986         CDS       T02283                                 

Gene name
FAM206A
Definition
(RefSeq) family with sequence similarity 206 member A
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_H
Motif
Other DBs
NCBI-GeneID: 100987986
NCBI-ProteinID: XP_003810943
UniProt: A0A2R9A253
Position
9
AA seq 181 aa AA seqDB search
MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSG
KTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLM
EVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINSTTAT
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgagcccgaagccgcggagccggtggtgccttcgctcgtggatcgatacttc
actcgctggtacaaaccggatgtcaaaggaaaattttgtgaggaccactgtatactacag
cactctaaccgaatatgtgtcatcacattggcagaatctcatccagttcttcaaagtgga
aaaacaattaaaagcatttcctatcagatcagtaccaactgtagcagacttcagaacaag
gtctctgggaaatttaagcggggggcacagtttctaacagagcttgcacctctctgtaag
atttactgctcagatggtgaagaatatactgtgtctagttgtgttagaggacgtttgatg
gaagtgaatgaaaacatcctccataagccatctattcttcaagaaaagccatctactgaa
ggctacattgcagttgtgttgcccaaatttgaagaaagtaaaagcataacagaagggtta
ctgacacaaaaacaatatgaagaagtcatggtgaaacgcattaattccacaacagctacg
tcatga

DBGET integrated database retrieval system