KEGG   Pan paniscus (bonobo): 100988129
Entry
100988129         CDS       T02283                                 

Gene name
KDM2B
Definition
(RefSeq) lysine demethylase 2B
  KO
K10276  F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100988129 (KDM2B)
   04121 Ubiquitin system [BR:pps04121]
    100988129 (KDM2B)
   03036 Chromosome and associated proteins [BR:pps03036]
    100988129 (KDM2B)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     100988129 (KDM2B)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    100988129 (KDM2B)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100988129 (KDM2B)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    100988129 (KDM2B)
SSDB
Motif
Pfam: PHD_4 zf-CXXC F-box JHD F-box-like Cupin_8 JmjC PHD
Other DBs
NCBI-GeneID: 100988129
NCBI-ProteinID: XP_003832407
UniProt: A0A2R9B6K0
Position
12
AA seq 1336 aa
MAGPQMGGSAEDHPPRKRHAAEKQKKKTVIYTKCFEFESATQRPIDRQRYDENEDLSDVE
EIVSVRGFSLEEKLRSQLYQGDFVHAMEGKDFNYEYVQREALRVPLIFREKDGLGIKMPD
PDFTVRDVKLLVGSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSH
TKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGCFTD
FHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIEL
KQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFYY
EMCWYVLERYVYCVTQRSHLTQEYQRESMLIDAPRKPSIDGFSSDSWLEMEEEACDQQPQ
EEEEKDEEGEGRDRAPKPPADGSTSPTSTPSEDQEALGKKPKAPALRFLKRTLSNESEES
VKSTTLAVDYPKTPTGSPATEVSAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIED
PQALLEGVKNVLKEHADDDPSLAITGVPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAAN
RTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTA
VCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECP
KCNHAGKTGKQKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDE
HPKKVPPDGLLRRKSDDVHLRKKRKYEKPQELSGRKRASSLQTSPGSSSHLSPRPPLGSS
LSPWWRSSLTYFQQQLKPGKEDKLFRKKRRSWKNAEDRMALANKPLRRFKQEPEDELPEA
PPKTRESDHSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLPNKELSRELSKELNHEIQR
TENSLANENQQPIKSEPESEGEEPKRPPGICERPHRFSKGLNGTPRELRHQLGPSLRSPP
RVISRPPPSVSPPKCIQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQ
DLCVCMRVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQ
LSWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTD
NRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLT
AVGTTTRDSLTEINLSDCNKVTDQCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSV
SVQFGQVEEKLLQKLS
NT seq 4011 nt   +upstreamnt  +downstreamnt
atggcgggtccgcaaatggggggatctgcagaggatcaccccccacgaaaaagacatgca
gcagaaaagcaaaaaaagaaaacagttatatatacaaaatgctttgaatttgagtcggcc
acacagcgcccgattgaccgccagcgatacgacgagaacgaggacttgtcggacgtggag
gagatcgtcagcgtccgcggcttcagcctggaggagaagcttcgcagccagctgtaccag
ggggacttcgtgcacgccatggagggcaaagatttcaactatgagtacgtacagagagaa
gctctcagggttcccctgatatttcgagaaaaggatggactgggaattaagatgcctgac
cctgatttcacagtccgagacgtcaaactcctagtggggagccggcggcttgtggacgtg
atggatgtgaacacccagaagggcacggagatgagcatgtcccagtttgtgcgttactac
gagacgcccgaggcccagcgggacaagctgtacaacgtcatcagcctagagttcagccac
accaagctggagcacttggtcaagcgtccgactgtggtagacctggtggactgggtggac
aacatgtggccccagcatctgaaggagaagcagacagaagccacgaacgccattgcagag
atgaagtacccgaaagtgaagaagtactgtctgatgagcgtgaaaggttgtttcactgac
ttccacatcgactttggaggcacttccgtttggtaccatgttttccggggtgggaagatt
ttttggctgattcctccaacgctgcacaatttggcgctgtacgaggagtgggtgctgtca
ggcaaacagagtgacatctttctgggagaccgtgtggaacgatgccaaagaattgagctg
aagcagggctacacatttttcatcccttccggttggatccatgccgtctacacccctgta
gactctttggtgttcggcggaaacatcctgcacagctttaacgtgcccatgcagctgcgg
atctacgagatcgaggacaggacgcgggtgcagcccaaattccgttaccccttctactat
gagatgtgctggtatgtcctggagagatacgtgtactgtgtgacccagcgctcccacctc
actcaggaataccagagggagtcgatgcttattgatgccccgaggaagcccagcatagac
ggcttctcttcggattcctggctggagatggaggaggaggcctgtgatcagcagcctcag
gaggaggaggagaaggacgaggagggcgagggcagggacagggcacccaaaccgcccgcc
gatggctccacttcacccaccagcacgccctccgaggaccaggaggccctcgggaagaag
cccaaagcacctgccctgcgattcctcaaaaggactttgtctaacgagtcggaggagagt
gtgaagtccaccacattggccgtagactaccccaagacccccaccggctctcccgccacg
gaggtctctgccaaatggacccatctcaccgagtttgaactgaagggcctgaaagctctg
gtggagaaactggaatccctcccggagaacaagaagtgtgtccccgagggcatcgaggac
ccccaggcactcctggagggtgtgaagaacgtcctgaaggagcacgcggatgatgatcct
agtctggccatcactggggtccctgtggtgacttggccaaagaagactccaaagaaccgg
gctgtgggtcggcccaaggggaagctgggcccggcctccgcggtgaagttggccgccaac
cggacaacggcaggagctcggcggcgccggacgcgatgccgcaagtgcgaggcctgcctg
cggaccgagtgcggagagtgccacttctgcaaggacatgaagaagttcgggggccccggg
cgcatgaagcagagctgcatcatgcggcagtgcatcgcgccagtgctgccccacaccgcc
gtgtgccttgtgtgtggcgaggcggggaaggaagacacggtggaagaggaggaaggcaag
tttaacctcatgctcatggagtgctccatctgcaatgaaatcatccaccctggatgcctt
aagattaaggagtcagagggtgtggtcaacgacgagcttccaaactgctgggagtgtccg
aagtgtaaccacgccggcaagaccgggaaacaaaagcgtggccctggctttaagtacgcc
tccaacctgcccggctccctgctcaaggagcagaagatgaaccgggacaacaaagaaggg
caggaacctgccaagcggaggagtgagtgtgaggaggcgccccggcgcaggtcggatgag
cacccgaagaaggtgccgccggacggcctcctgcgcagaaagtctgatgacgtgcacctg
aggaagaagcggaaatacgagaaaccccaggagctgagtggacgcaagcgggcctcatcg
cttcaaacgtcccccggttcctcctctcacctctcgccgaggccccctctaggcagcagc
ctcagcccctggtggagatccagtctcacttacttccagcagcagctcaaacctggcaaa
gaagataagcttttcaggaaaaagcggcggtcctggaagaacgccgaggaccgcatggcg
ctggccaacaagcccctccggcgcttcaagcaggaacccgaggacgaactgcccgaggcg
ccccccaagaccagggagagcgaccactcccgctccagctcccccaccgcgggacccagc
accgaaggggccgagggcccggaggagaagaagaaggtgaagatgcgccggaagcggcgg
cttcccaacaaggagctgagcagggagctgagcaaggagctcaaccacgagatccagagg
acggagaacagcctggccaacgagaaccagcagcccatcaagtcggagcccgagagcgag
ggcgaggagcccaagcggcccccgggcatctgcgagcgtccccaccgcttcagcaagggg
ctcaacggcaccccccgggagctgcggcaccagctggggcccagcctgcgcagcccgccc
cgtgtcatctcccggcccccaccctccgtgtctccgcccaagtgtatccagatggagcgc
catgtgatccggccaccccccatcagccccccgcctgactcgctacccctggacgatggg
gcagcccacgtcatgcacagggaggtgtggatggccgtcttcagctacctcagccaccaa
gacctgtgtgtgtgcatgcgggtctgcaggacctggaaccgctggtgctgcgataagcgg
ttgtggacccgcattgacctgaaccactgcaagtctatcacacccctgatgctgagtggc
atcatccggcgacagcccgtctccctcgacctcagctggaccaatatctccaagaagcag
ctgagctggctcatcaaccggctgcctgggctccgggacttggtgctgtcaggctgctca
tggatcgcggtctcggccctttgcagctccagttgtccgctgctccggaccctggatgtc
cagtgggtggagggactaaaggatgcccagatgcgggatctcctgtccccgcccacagac
aacaggccaggtcagatggacaatcggagcaagctccggaacatcgtggagctgcgcctg
gcaggcctggacatcacagatgcctccctgcggctcatcatccgccacatgcccctgctc
tccaagctccacctcagttactgtaaccacgtcaccgaccagtccatcaacctgctcacc
gctgttggcaccaccacccgagactccttaaccgagatcaacctgtctgactgcaataag
gtcactgatcagtgcctgtccttcttcaaacgctgtggaaacatctgtcatattgacctg
aggtactgcaagcaagtcaccaaggaaggctgtgagcagttcatagccgagatgtctgtg
agtgtccagtttgggcaagtagaagagaaactcctgcaaaaactgagttag

DBGET integrated database retrieval system