KEGG   Pan paniscus (bonobo): 100988257
Entry
100988257         CDS       T02283                                 

Gene name
IL15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04668  TNF signaling pathway
pps04672  Intestinal immune network for IgA production
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100988257 (IL15)
   04668 TNF signaling pathway
    100988257 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100988257 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100988257 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100988257 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100988257 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100988257 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100988257 (IL15)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100988257 (IL15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 100988257
NCBI-ProteinID: XP_003820741
UniProt: A0A2R9CIQ0
Position
4
AA seq 162 aa
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccatccagtgctacttgtgtttactt
ctaaacagtcattttctaactgaagctggcattcatgtcttcattttgggctgtttcagt
gcagggcttcctaaaacagaagccaactgggtgaatgtaataagtgatttgaaaaaaatt
gaagatcttattcaatctatgcatattgatgctactttatatacggaaagtgatgttcac
cccagttgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcactt
gagtccggagatgcaagtattcatgatacagtagaaaatctgatcatcctagcaaacaac
agtttgtcttctaatgggaatgtaacagaatctggatgcaaagaatgtgaggaactggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcaac
acttcttga

DBGET integrated database retrieval system