KEGG   Pan paniscus (bonobo): 100988349Help
Entry
100988349         CDS       T02283                                 

Gene name
SLITRK4
Definition
(RefSeq) SLIT and NTRK like family member 4
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 TPKR_C2 LRRNT LRR_1
Motif
Other DBs
NCBI-GeneID: 100988349
NCBI-ProteinID: XP_003816856
UniProt: A0A2R8ZDQ2
Position
X
AA seq 837 aa AA seqDB search
MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSN
FYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELK
ILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASL
THLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEA
ICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLV
TKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVN
CQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDV
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYL
NNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLV
ALKLWVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITF
TTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPD
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVV
MRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIR
YPEKQPDKKNKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttggctgtttctgattttgtcagccctgatttcttcgacaaatgcagattct
gacatatcggtggaaatttgcaatgtgtgttcctgcgtgtcagttgagaatgtgctctat
gtcaactgtgagaaggtttcagtctacagaccaaatcagctgaaaccaccttggtctaat
ttttatcacctcaatttccaaaataattttttaaatattctgtatccaaatacgttcttg
aatttttcacatgcagtctccctgcatctggggaataataaactgcagaacattgaggga
ggagcctttcttgggctcagtgcattaaagcagttgcacttgaacaacaatgaattaaag
attctccgagctgacactttccttggcatagagaacttggagtatctccaggctgactac
aatttaatcaagtatattgaacgaggagccttcaataagctccacaaactgaaagttctc
attcttaatgacaatctgatttcattccttcctgataatattttccgattcgcatctttg
acccatctggatatacgagggaacagaatccagaagctcccttatatcggggttctggaa
cacattggccgtgtcgttgaattgcaactggaagataacccttggaactgtagctgtgat
ttattgcccttaaaagcttggctggagaacatgccatataacatttacataggagaagct
atctgtgaaactcccagtgacttatatggaaggcttttaaaagaaaccaacaaacaagaa
ctatgtcccatgggcaccggcagtgattttgatgtgcgcatcctgcctccatctcagctg
gaaaatggctacaccactcccaatggtcacactacccaaacatctttacacagattagta
actaaaccaccaaaaacaacaaatccttccaagatctctggaatcgttgcaggcaaagcc
ctctccaaccgcaatctcagtcagattgtgtcttaccaaacaagggtgcctcctctaaca
ccttgcccggcaccttgcttctgcaaaacacacccttcagatttgggactaagtgtgaac
tgccaagagaaaaatatacagtctatgtctgaactgataccgaaacctttaaatgcgaag
aagctgcacgtcaatggcaatagcatcaaggatgtggacgtatcagacttcactgacttt
gaaggactggatttgcttcatttaggcagcaatcaaattacagtgattaagggagacgta
tttcacaatctcactaatttacgcaggctatatctcaatggcaatcaaattgaaagactc
tatcctgaaatattttcaggtcttcataacctgcagtatctgtatttggaatacaatttg
attaaggaaatctcagcaggcacctttgactccatgccaaacttgcagttactgtactta
aacaataatctcctaaagagcctgcctgtttacatcttttccggagcacccttagctaga
ctgaacctgaggaacaacaaattcatgtacctgcctgtcagtggggtccttgatcagttg
caatctcttacacagattgacttggagggcaacccatgggactgtacttgtgacttggtg
gcattaaagctgtgggtggagaagttgagcgacgggattgttgtgaaagaactgaaatgt
gagacgcctgttcagtttgccaacattgaactgaagtccctcaaaaatgaaatcttatgt
cccaaacttttaaataagccgtctgcaccattcacaagccctgcacctgccattacattc
accactcctttgggtcccattcgaagtcctcctggtgggccagtgcctctgtctatttta
atcttaagtatcttagtggtcctcattttaacggtgtttgttgctttttgccttcttgtt
tttgtcctgcgacgcaacaagaaacccacagtgaagcacgaaggcctggggaatcctgac
tgtggctccatgcagctgcagctaaggaagcatgaccacaaaaccaataaaaaagatgga
ctgagcacagaagctttcattccacaaactatagaacagatgagcaagagccacacttgt
ggcttgaaagagtcagaaactgggttcatgttttcagatcctccaggacagaaagttgtt
atgagaaatgtggccgacaaggagaaagatttattacatgtagataccaggaagagactg
agcacaattgatgagctggatgaattattccctagcagggattccaatgtgtttattcag
aattttcttgaaagcaaaaaggagtataatagcataggtgtcagtggctttgagatccgc
tatccagaaaaacaaccagacaaaaaaaataagaagtcactgataggtggcaaccacagt
aaaattgttgtggaacaaaggaagagtgagtattttgaactgaaggcgaaactgcagagt
tcccctgactacctacaggtccttgaggagcaaacagctttgaacaagatctag

DBGET integrated database retrieval system