KEGG   Pan paniscus (bonobo): 100988448Help
Entry
100988448         CDS       T02283                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100988448 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100988448 (CREM)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100988448 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 100988448
NCBI-ProteinID: XP_003814830
UniProt: A0A2R9BD08
Position
10
AA seq 270 aa AA seqDB search
MWWHQHNLCFRRPIEEDYSSGDVEEKVAAIAETDESAESEGVIDSHKRREILSRRPSYRK
ILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNP
GSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVPAATGDMPTYQI
RAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLE
SRVAVLEVQNKKLIEELETLKDICSPKTDY
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggcatcagcataatctatgtttcaggcgtcctatagaagaggattattcttca
ggggatgtggaagaaaaggtagcagcaattgcagagacagatgaatctgcagaatcagaa
ggtgtaattgattctcataaacgtagagaaatcctttcacgaagaccctcttataggaaa
atactgaatgaactgtcctctgatgtgcctggtgttcccaagattgaagaagagagatca
gaggaagaaggaacaccacctagtattgctaccatggcagtaccaactagcatatatcag
actagcacggggcaatacattgctatagcccaaggtggaacaatccagatttctaaccca
ggatctgatggtgttcagggactgcaggcattaacaatgacaaattcaggagctcctcca
ccaggtgctacaattgtacagtacgcagcacaatcagctgatggcacacagcagttcttt
gtcccaggcagccaggttgttgttccagctgccactggtgacatgccaacttaccagatc
cgagctcctactgctgctttgccacagggagtggtgatggctgcatcgcccggaagtttg
cacagtccccagcagctggcagaagaagcaacacgcaaacgagagctaaggctaatgaaa
aacagggaagctgccaaagaatgtcgacgtcgaaagaaagaatatgtaaaatgtctggag
agccgagttgcagtgctggaagtccagaacaagaagcttatagaggaacttgaaaccttg
aaagacatttgttctcccaaaacagattactag

DBGET integrated database retrieval system