KEGG   Pan paniscus (bonobo): 100988484
Entry
100988484         CDS       T02283                                 

Gene name
PSMA6
Definition
(RefSeq) proteasome subunit alpha 6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03050  Proteasome
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100988484 (PSMA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100988484 (PSMA6)
   05012 Parkinson disease
    100988484 (PSMA6)
   05016 Huntington disease
    100988484 (PSMA6)
   05017 Spinocerebellar ataxia
    100988484 (PSMA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100988484 (PSMA6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:pps03051]
    100988484 (PSMA6)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     100988484 (PSMA6)
Peptidases and inhibitors [BR:pps01002]
 Threonine peptidases
  Family T1: proteasome family
   100988484 (PSMA6)
Proteasome [BR:pps03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    100988484 (PSMA6)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 100988484
NCBI-ProteinID: XP_003821244
UniProt: A0A2R8ZU34
Position
14
AA seq 246 aa
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcccgtggttccagcgccggttttgaccgccacattaccattttttcacccgagggt
aggctctaccaagtagaatatgcttttaaggctattaaccagggtggccttacatcagta
gctgtcagagggaaagactgtgcagtaattgtcacacagaagaaagtacctgacaaatta
ttggattccagcacagtgactcacttattcaagataactgaaaacattggttgtgtgatg
accggaatgacagctgacagcagatcccaggtacagagggcacgctatgaggcagctaac
tggaaatacaagtatggctatgagattcctgtggacatgctgtgtaaaagaattgccgat
atttctcaggtctacacacagaatgctgaaatgaggcctcttggttgttgtatgatttta
attggtatagatgaagagcaaggccctcaggtatataagtgtgatcctgcaggttactac
tgtgggtttaaagccactgcagcgggagttaaacaaactgagtcaaccagcttccttgaa
aaaaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaattaca
tgcctgtctactgttctatcaattgatttcaaaccttcagaaatagaagttggagtagtg
acagttgaaaatcctaaattcaggattcttacagaagcagagattgatgctcaccttgtt
gctctagcagagagagactaa

DBGET integrated database retrieval system