KEGG   Pan paniscus (bonobo): 100988526
Entry
100988526         CDS       T02283                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04115  p53 signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04650  Natural killer cell mediated cytotoxicity
pps04668  TNF signaling pathway
pps04932  Non-alcoholic fatty liver disease
pps04940  Type I diabetes mellitus
pps05010  Alzheimer disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100988526 (FAS)
   04668 TNF signaling pathway
    100988526 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100988526 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100988526 (FAS)
   04217 Necroptosis
    100988526 (FAS)
   04115 p53 signaling pathway
    100988526 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100988526 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100988526 (FAS)
   05205 Proteoglycans in cancer
    100988526 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100988526 (FAS)
   05161 Hepatitis B
    100988526 (FAS)
   05160 Hepatitis C
    100988526 (FAS)
   05164 Influenza A
    100988526 (FAS)
   05162 Measles
    100988526 (FAS)
   05168 Herpes simplex virus 1 infection
    100988526 (FAS)
   05163 Human cytomegalovirus infection
    100988526 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100988526 (FAS)
   05169 Epstein-Barr virus infection
    100988526 (FAS)
   05165 Human papillomavirus infection
    100988526 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100988526 (FAS)
   05143 African trypanosomiasis
    100988526 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100988526 (FAS)
   05330 Allograft rejection
    100988526 (FAS)
   05332 Graft-versus-host disease
    100988526 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100988526 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100988526 (FAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100988526 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100988526 (FAS)
   04932 Non-alcoholic fatty liver disease
    100988526 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100988526 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100988526 (FAS)
   04090 CD molecules [BR:pps04090]
    100988526 (FAS)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100988526 (FAS)
CD molecules [BR:pps04090]
 Proteins
  100988526 (FAS)
SSDB
Motif
Pfam: TNFR_c6 Death Peptidase_C8
Other DBs
NCBI-GeneID: 100988526
NCBI-ProteinID: XP_003810564
UniProt: A0A2R9B6U6
Position
10
AA seq 335 aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEDLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLWWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKDAYDTLIKGLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgctgggcatctggaccctcctacctctggttcttacgtctgttgctagattatcgtcc
aaaagtgttaatgcccaagtgactgacatcaactccaagggactggaattgaggaagact
gttactacagttgagactcagaacttggaagacctgcatcatgatggccaattctgccat
aagccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatggggatgaacca
gactgcgtgccctgccaagaagggaaggagtacacagacaaagcccatttttcttccaaa
tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc
cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctactgtatgt
gaacactgtgacccttgcaccaaatgtgaacatggaatcatcaaggaatgcacacttacc
agcaacaccaagtgcaaagaggaaggatccagatctaacttgtggtggctttgtcttctt
cttttgccaattccactaattgtttgggtgaagagaaaggaagtacagaaaacatgcaga
aagcacagaaaggaaaaccaaggttctcatgaatctccaaccttaaatcctgaaacagtg
gcaataaatttatctgatgttgacttgagtaaatatatcaccactattgctggagtcatg
acactaagtcaagttaaaggctttgttagaaagaatggtgtcaatgaagccaaaatagat
gagatcaagaatgacaatgtccaagacacagcagaacagaaagttcaactgcttcgtaat
tggcatcaacttcatggaaagaaagatgcatatgacacattgattaaaggtctcaaaaaa
gccaatctttgtactcttgcagagaaaattcagactatcatcctcaaggacattactagt
gactcagaaaattcaaacttcagaaatgaaatccaaagcttggtctag

DBGET integrated database retrieval system