KEGG   Pan paniscus (bonobo): 100988563Help
Entry
100988563         CDS       T02283                                 

Gene name
SLC12A1
Definition
(RefSeq) solute carrier family 12 member 1
  KO
K14425  solute carrier family 12 (sodium/potassium/chloride transporter), member 1
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100988563 (SLC12A1)
   04147 Exosome [BR:pps04147]
    100988563 (SLC12A1)
Transporters [BR:pps02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   100988563 (SLC12A1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100988563 (SLC12A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12 AA_permease_N AA_permease_2
Motif
Other DBs
NCBI-GeneID: 100988563
NCBI-ProteinID: XP_003831528
UniProt: A0A2R8Z783
Position
15
AA seq 1099 aa AA seqDB search
MSLNNSSNVFLDSVPSNTNRFQVNVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRI
SFRSGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGS
ISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVKFGWV
KGVLVRCMLNIWGVMLFIRLSWIVGEAGIGLGVLIILLSTMVTSITGLSTSAIATNGFVR
GGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVDLLKESDSMMVDPTND
IRIIGSITVVILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSHNEKKSRGFFN
YQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIF
ITTVAYLGVAICVGACVVRDATGNMNDTIISGMNCNGSAACGLGYDFSRCRHEPCQYGLM
NNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIYKALQFFAKGYGK
NNEPLRGYILTFLIAMAFILIAELNTIAPIISNFFLASYALINFSCFHASYAKSPGWRPA
YGIYNMWVSLFGAVLCCAVMFVINWWAAVITYVIEFFLYVYVTYKKPDVNWGSSTQALSY
VSALDNALELTTVEDHVKNFRPQCIVLTGGPMTRPALLDITHAFTKNSGLCICCEVFVGP
RKLCVKEMNSGMGKKQVWLIKNKIKAFYAAVAADCFRDGVRSLLQASGLGRMKPNTLVIG
YKKNWRKAPLTEIENYVGIIHDAFDFEIGVVIVRISQGFDISQVLQVQEELERLEQERLA
LEATIKDTECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEAST
QFKKKQEKGTIDVWWLFDDGGLTLLIPYILTLRKKWKDCKLRIYVGGKINRIEEEKIAMA
SLLSKFRIKFADIHIIGDINIRPNKESWKVFEEMIEPYRLHESCKDLTTAEKLKRETPWK
ITDAELEAVKEKSYRQVRLNELLQEHSRAANLIVLSLPVARKGSISDLLYMAWLEILTKN
LPPVLLVRGNHKNVLTFYS
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgaacaactcttccaatgtatttctggattcagtgcccagtaataccaatcgc
tttcaagttaatgtcataaatgagaaccatgagagcagtgcagctgcagatgacaatact
gacccaccacattatgaagaaacctcttttggggatgaagctcagaaaagactcagaatc
agctttaggtctgggaatcaggagtgctatgacaatttcctccaaagtggagaaactgct
aaaacagatgccagttttcacgcttatgattctcacacaaacacatactatctacaaact
tttggccacaacaccatggatgccgttcccaagatagagtactatcgtaacaccggcagc
atcagtgggcccaaggtcaaccgacccagcctgcttgagattcacgagcaactcgcaaag
aatgtggcagtcaccccaagttcagctgacagagttgctaatggtgatgggatacctgga
gatgaacaagctgaaaataaggaagatgatcaagctggtgttgtgaagtttggatgggtg
aaaggtgtgctggtaagatgcatgctgaacatctggggagtcatgctcttcattcgcctc
tcctggattgtcggagaagctggaattggtcttggagttctcataattcttctttccacc
atggtaacttctattactgggttgtcaacttctgcgatagcaactaacgggtttgttcgt
ggaggtggtgcctactatcttatttccagaagtttagggcccgagttcggtgggtcaata
ggcctgatctttgcttttgctaatgcagtggctgttgctatgtatgtggtgggatttgct
gagactgtagtagatcttcttaaggagagtgattcgatgatggtggatccaaccaatgac
atccggattataggctccatcacagtggtgattcttctaggaatttcagtagctggaatg
gaatgggaggcaaaggcccaagtcattcttctggtcattcttctaattgctattgcaaac
ttcttcattggaactgtcattccatcccacaatgagaaaaagtccagaggtttctttaat
taccaagcatcaatatttgcagaaaactttgggccacgcttcacaaagggtgaaggcttc
ttctctgtctttgccatttttttcccagcagctactgggattcttgctggtgccaatatc
tcaggagatttggaggatccccaagatgccatccccagaggaaccatgctggccattttc
atcaccactgttgcctacttaggggttgcaatttgtgtaggggcctgtgtggtccgagat
gccaccgggaacatgaatgacaccatcatttctgggatgaactgcaatggttcagcagca
tgtgggttgggctatgacttctcaagatgtcgacatgaaccatgtcagtacgggctgatg
aacaatttccaggtcatgagcatggtatcagggtttggccccctcatcactgcgggaatc
ttttctgcaacactctcctccgccctggcctcccttgtcagcgcacccaaagtgttccag
gctctgtgcaaggacaacatctacaaagccctgcagttttttgcaaagggatacgggaaa
aacaatgaacccctgagaggatatattctcacttttcttatagccatggcatttattctt
attgcggaactgaacaccattgctcccatcatctccaactttttcctggcctcatatgca
cttattaatttctcctgcttccatgcctcttatgccaagtctccaggatggagacctgcg
tatggaatttacaacatgtgggtatctctttttggagctgttttgtgctgtgcagtcatg
tttgtcatcaactggtgggcagctgtcatcacctatgtcattgaattcttcctttacgtc
tatgtgacttataagaagccagatgtgaactggggctcctccacacaggctctttcctat
gtgagtgctttagacaatgctctggaattaaccacagtggaagaccacgtaaaaaacttc
aggccccagtgcattgtcttaacagggggacccatgacaagacctgctctcctggacata
actcacgcctttaccaagaacagtggcctttgcatctgctgtgaagtctttgtgggaccg
cgcaaactgtgtgttaaggagatgaacagtggcatggggaaaaaacaggtctggcttata
aagaacaaaatcaaggctttttatgctgcagtggcggcagactgtttcagggatggtgtc
cgaagtcttcttcaggcctcaggcttaggaagaatgaaaccaaacactctggtgattgga
tataagaaaaactggaggaaagctcccttgacagagattgagaactacgtgggaatcata
catgatgcatttgattttgagattggcgtggttatagtcagaatcagccaaggatttgac
atctctcaggttcttcaggtgcaagaggaattagagagattagaacaggagagactagca
ttggaagcaactatcaaagatactgagtgtgaagaggaaagtggaggcatccgaggcttg
tttaaaaaagctggcaagttgaacattactaagacaacgcctaaaaaagatggcagcatt
aacacaagccagtcgatgcatgtgggagagttcaaccagaaactggtggaagccagcact
caatttaaaaagaaacaagaaaaaggcacaattgatgtttggtggttgtttgatgatgga
gggttaacacttcttatcccctatatcttgactctcagaaaaaaatggaaagactgtaaa
ttaagaatctatgtgggagggaagatcaaccgcattgaagaagaaaaaattgcaatggct
tcccttctgagcaaatttaggataaaatttgcagacatccatatcatcggtgacatcaac
attaggccaaacaaagagagctggaaagtctttgaagagatgattgaaccatatcgtctc
catgaaagctgcaaagatttaacaactgctgagaaattaaaaagagaaactccgtggaaa
attacagatgcagaactggaagcagtcaaggaaaagagttaccgccaagttcgactgaat
gaactcttacaggagcactccagagctgctaatctcattgtcctgagccttcccgtggca
agaaagggatccatatcggatttgttgtatatggcttggttggaaatcctcacaaagaac
ctcccacctgtcttactagttagaggaaatcacaaaaatgtcttgacattttactcttaa

DBGET integrated database retrieval system