KEGG   Pan paniscus (bonobo): 100988946
Entry
100988946         CDS       T02283                                 

Gene name
KCNE2
Definition
(RefSeq) potassium voltage-gated channel subfamily E regulatory subunit 2
  KO
K04896  potassium voltage-gated channel Isk-related subfamily E member 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100988946 (KCNE2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100988946 (KCNE2)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100988946 (KCNE2)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 100988946
NCBI-ProteinID: XP_003824018
UniProt: A0A2R8Z7W7
Position
21
AA seq 123 aa
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQARVDAENFYYVILYLMVMIGMF
SFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFK
MSP
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtctactttatccaatttcacacagacgctggaagacgtcttccgaaggatttttatt
acttatatggacaattggcgccagaacacgacagctgagcaagaggccctccaagccaga
gttgatgctgagaacttctactatgtcatcctgtacctcatggtgatgattggaatgttc
tctttcatcatcgtggccatcctggtgagcactgtgaaatccaagagacgggaacactcc
aatgacccctaccaccagtacattgtagaggactggcaggaaaagtacaagagccaaatc
ttgaatctagaagaatcgaaggccaccatccatgagaacattggtgcggctgggttcaaa
atgtccccctga

DBGET integrated database retrieval system