KEGG   Pan paniscus (bonobo): 100989039
Entry
100989039         CDS       T02283                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100989039 (AHRR)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100989039 (AHRR)
SSDB
Other DBs
NCBI-GeneID: 100989039
NCBI-ProteinID: XP_008962649
Position
5
AA seq 566 aa
MPCACTERARLLRCRCPHGRDAGQGDADGCNAPEHLRLHPRGRPPGLLPAAPLGHGPSPG
DDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQK
RKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATTDAKVKATTSLC
ESELHGKPNYSAGRSSRESGVLVLREQTDADRWAQVPARAPCLCLRGGPDLVLDPKGGSG
DREEEQHRMLSRASGMTGRRDTPGPTKPLPWTAGKYSEDGARPRLQPSKNDPRSLRPTPR
GSCLPYPCVQGTFRNSPISHPPSPSPSAYSSRTSRPVREVGEDQVHPPLCHFPQGSLQHQ
LPQPGAQRFATRGYPMEDVKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEDAADGCVPS
QVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPF
HPAHCACLEPTHGLPQSEPPHQLCARGRGEQSCTCRDAEAAPVVKREPLDSPQWATHSQG
VVPGMFPKSALATLVPPQASGCTFLP
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgccgtgtgcatgcacggaacgggcgaggctgttgcgctgcaggtgcccccacggtcgc
gatgcagggcagggggatgctgacggatgtaatgcaccagaacatttacgactacatcca
cgtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccagga
gatgatgctatcctggggaggctgctcagggcccaggagtggggcacaggcacgcccacc
gagtactcggccttcctgacccgctgcttcatctgccgtgtgcgctgcctgctggacagc
acctcgggcttcctgacgatgcagtttcaaggaaaactaaaattcctgtttggacagaag
aggaaggcgccgtcaggagccatgctcccgccgcggctgtcgctgttctgcattgcggca
cccgttctcctcccctccgcagcggagatgaaaatgaggagcgcgctcctgagggcaaaa
cccagggcagacaccgcagccaccacggatgcaaaagtaaaagccaccaccagtctgtgc
gaatcggaactgcatggaaaacccaattactcagcaggaaggagcagcagagagagcggc
gttttggtgctcagggaacagactgacgctgaccgatgggcacaggttcccgccagggcc
ccatgcctgtgcctccggggcggccctgaccttgtccttgaccccaaggggggctcaggg
gacagggaggaggagcagcacaggatgctgagcagggcctctggaatgacagggcggagg
gacactccaggacccacaaagcccctgccctggacagcgggaaagtacagtgaggatggt
gccaggccgaggctgcagcccagcaagaatgacccgcgctccctgcgccccacgccccgc
ggctcctgcctgccctacccgtgtgtccagggcactttcaggaactcacccatctctcac
ccgccgagcccgtcccccagtgcctactccagccggaccagcagacccgtgcgggaagtc
ggtgaggaccaggtacaccctcccctctgccactttccccaggggagcctgcagcaccag
ctccctcagcctggagctcagcgttttgccacgaggggctatcccatggaggacgtgaag
ctgcaaggtgtaccgatgcctccgggggacctgtgtggtccgacgctgctgctagatgtg
tccatcaagatggagaaggactctgggtgtgaggatgctgcagacggctgtgtgcccagc
caggtgtggctgggggccagtgacaggagccacccagccaccttccctaccaggatgcac
ctgaaaacagagccagactctcggcaacaggtgtacatctcgcacctggggcacggcgtg
cggggggctcagccccatgggagggccactgctgggcgcagcagggagctgacccctttc
caccctgcacactgtgcctgcctggagcccacacatggccttccccagtcggagcctccc
caccagctctgtgcacggggccgaggtgaacagtcctgcacctgcagagatgctgaggcc
gcccctgtggtcaagcgggagcccttggactcgccccagtgggctactcacagccaggga
gtggtgcccgggatgtttcccaaaagtgccttggccacgctggtcccgccccaagcttcg
gggtgcacattcctgccatag

DBGET integrated database retrieval system