KEGG   Pan paniscus (bonobo): 100989067
Entry
100989067         CDS       T02283                                 

Gene name
STAT6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05161  Hepatitis B
pps05200  Pathways in cancer
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100989067 (STAT6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100989067 (STAT6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100989067 (STAT6)
   04659 Th17 cell differentiation
    100989067 (STAT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100989067 (STAT6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100989067 (STAT6)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100989067 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100989067 (STAT6)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100989067 (STAT6)
SSDB
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Other DBs
NCBI-GeneID: 100989067
NCBI-ProteinID: XP_003824932
UniProt: A0A2R9ACC9
Position
12
AA seq 847 aa
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWDKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
VQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVCPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGVGSLGAQPLLQPSHYGQSGISMSHMD
LRANPSW
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctctaagatgcccccagaaaaagtgcagcggctctatgtc
gactttccccaacacctgcggcatcttctgggtgactggctggagagccagccctgggag
ttcctggtcggctccgacgccttctgctgcaacttggctagtgccctactttcagacact
gtccagcaccttcaggcctcggtgggagagcagggggaggggagcaccatcttgcaacac
atcagcacccttgagagcatatatcagagggaccccctgaagctggtggccactttcaga
caaatacttcaaggagagaaaaaagctgttatggaacagttccgccacttgccaatgcct
ttccactggaagcaggaagaactcaagtttaagacaggcttgcggaggctgcagcaccga
gtaggggagatccaccttctccgagaagccctgcagaagggggctgaggctggccaagtg
tctctgcacagcttgatagaaactcctgctaatgggactgggccaagtgaggccctggcc
atgctactgcaggagaccactggagagctagaggcagccaaagccctagtgctgaagagg
atccagatttggaaacggcagcagcagctggcagggaatggcgcaccatttgaggagagc
ctggccccactccaggagaggtgtgagagcctggtggacatttattcccagctacagcag
gaggtaggggcggctggtggggagcttgagcccaagacccgggcatcgctgactggccgg
ctggatgaagtcctgagaaccctcgtcaccagttgcttcctggtggagaagcagcccccc
caggtactgaagactcagaccaagttccaggctggagttcgattcctgttgggcttgagg
ttcctgggggccccagccaagcctccgctggtcagggccgacatggtgacagagaagcag
gcgagggagctgagtgtgcctcagggtcctggggctggagcagaaagcactggagaaatc
atcaacaacactgtgcccttggagaacagcattcctgggaactgctgctctgccctgttc
aagaacctgcttctcaagaagatcaagcggtgtgagcggaagggcactgagtctgtcaca
gaggagaagtgcgctgtgctcttctctgccagcttcacacttggccccggcaaactcccc
atccagctccaggccctgtctctgcccctggtggtcatcgtccatggcaaccaagacaac
aatgccaaagccactatcctgtgggacaatgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggacaagatgtgtgaaactctgaacctgaagttcatg
gctgaggtggggaccaaccgggggctgctcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcagtatggaggccttccagcaccgttctgtgtcctggtcg
cagttcaacaaggagatcctgctgggccgtggcttcaccttttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtctgaccggctgatcattggc
ttcatcagcaaacagtatgttactagccttcttctcaatgagcccgacggaacctttctc
ctccgcttcagcgactcagagattgggggcatcaccattgcccatgtcatccggggccag
gatggctctccacagatagagaacatccagccattctctgccaaagacctgtccattcgc
tcactgggggaccgaatccgggatcttgctcagctcaaaaacctctatcccaagaagccc
aaggatgaggctttccggagccactacaagcctgaacagatgggtaaggatggcaggggt
tatgtcccagctaccatcaagatgaccgtggaaagggaccaaccacttcctaccccagag
gtccagatgcctaccatggtgccttcttatgaccttggaatggcccctgattcctccatg
agcatgcagcttggcccagatatggtgccccaggtgtgcccaccacactctcactccatc
cccccgtatcaaggcctctccccagaagaatcagtcaacgtgttgtcagccttccaggag
cctcacctgcagatgccccccagcctgggccagatgagcctgccctttgaccagcctcac
ccccagggcctgctgccgtgccagcctcaggagcatgctgtgtccagccctgaccccctg
ctctgctcagatgtgaccatggtggaagacagctgcctgagccagccagtgacagcgttt
cctcagggcacttggattggtgaagacatattccctcctctgctgcctcccactgaacag
gacctcactaagcttctcctggaggggcaaggggagtcgggggtagggtccttgggggca
cagcccctcctgcagccctcccactatgggcaatctgggatctcaatgtcccacatggac
ctaagggccaaccccagttggtaa

DBGET integrated database retrieval system