KEGG   Pan paniscus (bonobo): 100989118Help
Entry
100989118         CDS       T02283                                 

Gene name
NELFE, RDBP
Definition
(RefSeq) negative elongation factor complex member E
  KO
K15182  negative elongation factor E
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pps03021]
    100989118 (NELFE)
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     100989118 (NELFE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 100989118
NCBI-ProteinID: XP_003831584
UniProt: A0A2R9BWZ2
Position
6
AA seq 382 aa AA seqDB search
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVVDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDL
QESSRRPQRKSLYESFVSSSDRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSA
SPPRSCSRDRSHERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRDRERDRDRERDR
DRDREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCA
FVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCH
RDKRTQIVYSDDVYKENLVDGF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgataccccccggactgagcgaggaagaggaggctctgcagaagaaattcaac
aaactcaagaaaaagaaaaaggcattgctggctctgaagaagcaaagtagcagcagcaca
accagccaaggtggtgtcaaacgctcactatcagagcagcctgtcgtggacacagccaca
gcaacagagcaggcaaagcagctggtgaagtcaggagccatcagtgccatcaaggctgag
accaagaactcaggcttcaagcgttctcgaacccttgaggggaagttaaaggaccccgag
aagggaccagtccccactttccagccgttccagaggagcatatctgctgatgatgacctg
caagagtcatccagacgtccccagaggaaatctctgtatgagagctttgtgtcttctagt
gatcgacttcgagaactaggaccagatggagaagaggcagagggcccaggggctggtgat
ggtccccctcgaagctttgactggggctatgaagaacgcagtggtgcccactcctcagcc
tcccctccccgaagctgcagccgggaccgcagccatgagaggaaccgggacagagaccga
gatcgggagcgggatcgagaccgggatcgagacagagacagagagcgggacagggatcgg
gatcgggatcgggatcgagatcgagaccgggaacgggacagggatcgggagcgggatcga
gaccgagaccgagagggtcctttccgcaggtcggattcattccctgaacggcgagcccct
aggaaagggaataccctctatgtatatggagaagacatgacacccacccttctccgtggg
gccttctctccttttggaaacatcattgacctctccatggacccacccagaaactgtgcc
ttcgtcacctatgaaaagatggagtcagcagatcaggccgttgctgagctcaacgggacc
caggtggagtctgtacagctcaaagtcaacatagcccgaaaacagcccatgctggatgcc
gctactggcaagtctgtctggggctccctcgctgtccagaacagccctaagggttgccac
cgggacaagaggacccagattgtctacagtgatgacgtctacaaggaaaaccttgtggat
ggcttctag

DBGET integrated database retrieval system