KEGG   Pan paniscus (bonobo): 100989138
Entry
100989138         CDS       T02283                                 

Gene name
JMJD6
Definition
(RefSeq) arginine demethylase and lysine hydroxylase
  KO
K11323  histone arginine demethylase JMJD6 [EC:1.14.11.-]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100989138 (JMJD6)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     100989138 (JMJD6)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    100989138 (JMJD6)
SSDB
Motif
Pfam: JmjC Cupin_8 AF-4
Other DBs
NCBI-GeneID: 100989138
NCBI-ProteinID: XP_003818343
UniProt: A0A2R9A0Q2
Position
17
AA seq 414 aa
MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFV
ERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEY
MESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPP
RSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIKVTRDEGGNQQDEAITWFNVIY
PRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHK
TVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSSSSSSSDSDSE
CESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSRIRDTCGGRAHP
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaaccacaagagcaagaagcgcatccgcgaggccaagcggagtgcgcggccggagctc
aaggactcgctggattggacccggcacaactactacgagagcttctcgctgagcccggcg
gccgtggcggataacgtggaaagggcagatgctttacagctgtctgtggaagaatttgtg
gagcggtatgaaagaccttacaagcccgtggttttgttgaatgcgcaagagggctggtct
gcgcaggagaaatggactctggagcgcctaaaaaggaaatatcggaaccagaagttcaag
tgtggtgaggataacgatggctactcagtgaagatgaagatgaaatactacatcgagtac
atggagagcactcgagatgatagtcccctttacatctttgacagcagctatggtgaacac
cctaaaagaaggaaacttttggaagactacaaggtgccaaagtttttcactgatgacctt
ttccagtatgctggggagaagcgcaggcccccctacaggtggtttgtgatggggccacca
cgctccggaactgggattcacatcgaccctctgggaaccagtgcctggaatgccttagtt
cagggccacaagcgctggtgcctgtttcctaccagcactcccagggagctcatcaaagtg
acccgagacgaaggagggaaccagcaagacgaagctattacctggtttaatgttatttat
ccccggacacagcttccaacctggccacctgaattcaaacccctggaaatcttacaaaaa
ccaggagagactgtctttgtaccaggaggctggtggcatgttgtcctcaatctcgacact
actatcgccatcacccaaaattttgccagcagcaccaacttccctgtggtatggcacaag
acggtaagagggagaccaaagttatcaaggaaatggtataggatcttgaagcaagagcac
cccgagttggcagtcctggcagactcggttgaccttcaggagtccacagggatagcttcc
gacagctccagcgactcttccagctcctccagctccagttcgtcagactccgactcagag
tgcgagtctggatccgagggcgatgggacagtgcaccgcaggaagaagaggaggacgtgc
agcatggtgggaaacggggacaccacctcccaggacgactgtgtcagcaaagagcgcagc
tcctccaggattagggacacttgtggaggccgggctcacccctga

DBGET integrated database retrieval system