KEGG   Pan paniscus (bonobo): 100989146
Entry
100989146         CDS       T02283                                 

Gene name
OGT
Definition
(RefSeq) O-linked N-acetylglucosamine (GlcNAc) transferase
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00514  Other types of O-glycan biosynthesis
pps04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100989146 (OGT)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100989146 (OGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pps01003]
    100989146 (OGT)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100989146 (OGT)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     100989146 (OGT)
Glycosyltransferases [BR:pps01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   100989146 (OGT)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     100989146 (OGT)
SSDB
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_17 TPR_12 TPR_14 TPR_16 TPR_19 TPR_7 TPR_10 TPR_6 TPR_9 NARP1 TPR_MalT TPR_15 FAT MIT TPR_21 Wzy_C_2 EST1_DNA_bind SNAP BTAD ANAPC3 Tcf25
Other DBs
NCBI-GeneID: 100989146
NCBI-ProteinID: XP_003820179
UniProt: A0A2R9AEH2
Position
X
AA seq 1046 aa
MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHK
PPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
MWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAV
IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMN
TIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQL
TCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLY
LQMWEHYAAGNKPDHMIKPVEVTESA
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggcgtcttccgtgggcaacgtggccgacagcacagaaccaacgaaacgtatgctttcc
ttccaagggttagctgagttggcacatcgagaatatcaggcaggagattttgaggcagct
gagagacactgcatgcagctctggagacaagagccagacaatactggtgtgcttttatta
ctttcatctatacacttccagtgtcgaaggctggacagatctgctcactttagcactctg
gcaattaaacagaacccccttctggcagaagcttattcgaatttggggaatgtgtacaag
gaaagagggcagttgcaggaggcaattgagcattatcgacatgcattgcgtctcaaacct
gatttcatcgatggttatattaacctggcagccgccttggtagcagcgggtgacatggaa
ggggcagtacaagcttacgtctctgctcttcagtacaatcctgatttgtactgtgttcgc
agtgacctggggaacctgctcaaagccctgggtcgcttggaagaagccaaggcatgttat
ttgaaagcaattgagacgcaaccgaactttgcagtagcttggagtaatcttggctgtgtt
ttcaatgcacaaggggaaatttggcttgcgattcatcactttgaaaaggctgtcaccctt
gacccaaactttctggatgcttatatcaatttaggaaatgtcttgaaagaggcacgcatt
tttgacagagctgtggcagcttatcttcgtgccctaagtttgagtccaaatcacgcagtg
gtgcacggcaacctggcttgtgtatactatgagcaaggcctgatagatctggcaatagac
acctacaggcgggctatcgaactacaaccacatttccctgatgcttactgcaacctagcc
aatgctctcaaagagaagggcagtgttgctgaagcagaagattgttataatacagctctc
cgtctgtgtcccacccatgcagactctctgaataacctagccaatatcaaacgagaacag
ggaaacattgaagaggcagttcgcttgtatcgtaaagcattagaagtcttcccagagttt
gctgctgcccattcaaatttagcaagtgtactgcagcagcagggaaaactgcaggaagct
ctgatgcattataaggaggctattcgaatcagtcctacctttgctgatgcctactctaat
atgggaaacactctaaaggagatgcaggatgttcagggagccttgcagtgttatacgcgt
gccatccaaattaatcctgcatttgcagatgcgcatagcaatctggcttccattcataag
gattcagggaatattccagaagctatagcttcttaccgcacggctctgaaacttaagcct
gattttcctgatgcttattgtaacttggctcattgcctgcagattgtctgtgattggaca
gactatgatgagcgaatgaagaagttggtcagtattgtggctgaccagttagagaagaat
aggttgccttctgtgcatcctcatcatagtatgctatatcctctttctcatggcttcagg
aaggctattgctgagaggcacggcaacctgtgcttagataagattaatgttcttcataaa
ccaccatatgaacatccaaaagacttgaagctcagtgatggtcggctgcgtgtaggatat
gtgagttccgactttgggaatcatcctacttctcaccttatgcagtctattccaggcatg
cacaatcctgataaatttgaggtgttctgttatgccctgagcccagacgatggcacaaac
ttccgagtgaaggtgatggcagaagccaatcatttcattgatctttctcagattccatgc
aatggaaaagcagctgatcgcatccatcaggatggaattcatatccttgtaaatatgaat
ggctatactaagggcgctcgaaatgagctttttgctctcaggccagctcctattcaggca
atgtggctgggataccctgggacgagtggtgcgcttttcatggattatattatcactgat
caggaaacttcgccagctgaagttgctgagcagtattctgagaaattggcttatatgccc
cacactttttttattggtgatcatgctaatatgttccctcacctgaagaaaaaagcagtc
atcgattttaagtccaatgggcacatttatgacaatcggatagttctgaatggcatcgac
ctcaaagcatttcttgatagtctaccagatgtgaaaattgtcaagatgaagtgtcctgat
ggaggagacaatgcagatagcagtaacacagctcttaatatgcctgttattcctatgaat
actattgcagaagcagttattgaaatgattaacagaggacagattcaaataacaattaat
ggattcagtattagcaatggactggcaactactcagatcaacaataaggctgcaactgga
gaggaggttccccgtaccattattgtaaccacccgttctcagtacgggttaccagaagat
gccatcgtatactgtaactttaatcagttgtataaaattgacccttctactttgcagatg
tgggcaaacattctgaagcgtgttcccaatagtgtactctggctgttgcgttttccagca
gtaggagaacctaatattcaacagtatgcacaaaacatgggcctgccccagaaccgtatc
attttttcacctgttgctcctaaagaggaacacgtcaggagaggccagctggctgatgtc
tgcttggacactccactctgtaatgggcacaccacagggatggatgtcctctgggcaggg
acccccatggtgactatgccaggagagactcttgcttctcgagttgcagcatcccagctc
acttgcttaggttgtcttgagcttattgctaaaaacagacaagaatatgaagacatagct
gtgaagctgggaactgatctagaatacctgaagaaagttcgtggcaaagtctggaagcaa
agaatatctagccctctgttcaacaccaaacaatacacaatggaactagagcggctctat
ctacagatgtgggagcattatgcagctggcaacaaacctgaccacatgattaagcctgtt
gaagtcactgagtcagcataa

DBGET integrated database retrieval system