KEGG   Pan paniscus (bonobo): 100989272Help
Entry
100989272         CDS       T02283                                 

Gene name
PRSS27
Definition
(RefSeq) protease, serine 27
  KO
K09628  serine protease 27 [EC:3.4.21.-]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100989272 (PRSS27)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100989272 (PRSS27)
Peptidases and inhibitors [BR:pps01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100989272 (PRSS27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100989272
NCBI-ProteinID: XP_003805596
UniProt: A0A2R8ZPG1
Position
16
AA seq 290 aa AA seqDB search
MRRPAAVPLLLLLCFGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFC
GGSLIAEQWVLTAAHCFPNTSETSLYQVLLGARQLVQPGPHAMYARVRRVESNPLYQGMA
SSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQK
LAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQS
WLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQPARSGSQK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggcccgcggcggtgccgctcctgctgctgctgtgttttgggtctcagagggcc
aaggcagcaacagcctgtggtcgccccaggatgctgaaccgaatggtgggcgggcaggac
acgcaggagggcgagtggccctggcaagtcagcatccagcgcaacggaagccacttctgc
gggggcagcctcatcgcggagcagtgggtcctgacggccgcgcactgcttccccaacacc
tctgagacgtccctgtaccaggtcctgctgggggcaaggcagctagtgcagccgggacca
cacgctatgtatgcccgggtgaggcgggtggagagcaaccccctgtaccagggcatggcc
tccagcgctgacgtggccctggtggagctggaggcaccagtgcccttcaccaattacatc
ctccccgtgtgcctgcctgacccctcggtgatctttgagacgggcatgaactgctgggtc
actggctggggcagccccagtgaggaagacctcctgcccgaaccgcggatcctgcagaaa
ctcgctgtgcccatcatcgacacacccaagtgcaacctgctctacagcaaagacaccgag
tttggctaccaacccaaaaccatcaagaatgacatgctgtgcgccggcttcgaggagggc
aagaaggatgcctgcaagggcgactcgggcggccccctggtgtgcctcgtgggtcagtcg
tggctgcaggccggggtgatcagctggggtgagggctgtgcccgccagaaccgcccaggt
gtttacatccgtgtcaccgcccaccacaactggatccatcggatcatccccaaactgcag
ttccagccagcaaggtcgggcagccagaagtga

DBGET integrated database retrieval system