KEGG   Pan paniscus (bonobo): 100989498
Entry
100989498         CDS       T02283                                 

Gene name
SHB
Definition
(RefSeq) SH2 domain containing adaptor protein B
  KO
K23697   
Organism
pps  Pan paniscus (bonobo)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 100989498
NCBI-ProteinID: XP_008966142
UniProt: A0A2R9AZ68
Position
9
AA seq 285 aa
AASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQ
ESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNR
VTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVP
LEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKE
KYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
NT seq 858 nt   +upstreamnt  +downstreamnt
gccgcctcagccgcggaggagagcggggccggcaagaaggacaaggtgaccatagccgat
gactactcagatccctttgatgccaagaatgatctcaagagcaaagcaggaaagggggag
agtgctggctacatggagccctatgaggcacagaggatcatgacagaatttcagaggcag
gaaagtgtccggtcccagcataaaggtatccagttatatgacaccccttacgaacctgaa
ggccaaagtgttgactcagactcggagagcacagtcagcccccgactgcgggagagcaag
ctgccccaggatgacgacaggcccgccgatgagtacgaccagccttgggagtggaaccgg
gtcaccatcccagccctggcagcacagtttaatggcaacgagaagcggcagtcatccccc
tcaccttcgcgggaccggcggcgccagcttcgtgcccctggagggggctttaagcctatc
aaacatgggagccccgagttctgcgggatcctaggagaaagggtggatcctgccgtcccc
ctggagaagcaaatatggtatcacggagccatcagcagaggagacgccgagaacctgctg
cgactctgcaaggagtgtagctaccttgtccggaacagccagaccagcaagcatgactac
tccctctccctgaggagcaaccagggttttatgcacatgaaactggccaaaaccaaagag
aaatacgttctgggtcagaacagccctccgttcgacagtgtcccggaagtcatccactac
tacaccaccagaaagctgcccatcaaaggggctgagcacttgtccctcctctatcccgtg
gctgtgaggaccctgtga

DBGET integrated database retrieval system