KEGG   Pan paniscus (bonobo): 100989685Help
Entry
100989685         CDS       T02283                                 

Gene name
CPLX2
Definition
(RefSeq) complexin 2
  KO
K15294  complexin-1/2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100989685 (CPLX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100989685 (CPLX2)
Membrane trafficking [BR:pps04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100989685 (CPLX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaphin LD_cluster2 Spt5_N RR_TM4-6
Motif
Other DBs
NCBI-GeneID: 100989685
NCBI-ProteinID: XP_003814065
UniProt: A0A2R9BKE2
Position
5
AA seq 134 aa AA seqDB search
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgtcatgaagcaggcccttggaggggccacaaaggacatggggaagatgctg
gggggagaggaagagaaggaccccgacgcgcagaaaaaggaggaggagcggcaggaggcg
ctgcggcagcaggaggaggagcgtaaggccaagcacgcgcgcatggaggcggagcgggag
aaggtccggcagcagatccgagataagtatgggctgaagaagaaggaggagaaggaagca
gaggagaaagcagccctggagcagccctgcgaggggagcctgacccggcccaagaaggcc
atccctgcgggctgcggggacgaggaggaggaggaagaggagagcatcctggacacggtg
ctcaagtacctgcccgggccgctgcaggacatgttcaagaagtaa

DBGET integrated database retrieval system