KEGG   Pan paniscus (bonobo): 100989737Help
Entry
100989737         CDS       T02283                                 

Gene name
OPTC
Definition
(RefSeq) opticin
  KO
K08128  opticin
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:pps00535]
    100989737 (OPTC)
Proteoglycans [BR:pps00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    100989737 (OPTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 100989737
NCBI-ProteinID: XP_003823034
UniProt: A0A2R9CN77
Position
1
AA seq 332 aa AA seqDB search
MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVI
DLSNYEELTDYGDQLPEVKMTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQ
PNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLK
RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQP
AAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQ
LEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcctggctttcctgagtctgctggccttggtgctgcaggagacagggacagct
tctctcccaaggaaggagaggaagaggagagaggagcagatgcccagggaaggcgattcc
tttgaagttctgcctctgcggaatgatgtcctgaacccagacaactatggtgaagtcatt
gacctgagcaactatgaggagctcacagattatggggaccaactccccgaggttaagatg
actagcctcgctcctgcaaccagcatcagtcccgccaagagcactacggctccagggaca
ccctcatcaaaccccacgatgaccagacctactacagcagggctgctactgagttcccag
cccaaccatggtctgcccacctgcctggtctgcgtgtgcctcggttcctctgtgtattgc
gatgacattgacctagaggacattcctcctcttcctcggaggactgcctacctgtatgca
cgcttcaaccgcatcagccgtatcagggccgaagacttcaaagggctgacaaagttgaag
aggattgacctctccaacaacctcatttcctccatcgataatgatgccttccgcctgcta
catgccctccaggacctcatcctcccagagaaccagttggaagctctgcccgtgctgccc
agtggcattgagttcctggatgtccgcctaaatcggctccagagctcggggatacagcct
gcagccttcagggcaatggagaagcttcagttcctttacctgtcagacaacctgctggat
tctatcccggggcctttgcccctgagcctgcgctctgtacacctgcagaataacctgata
gagaccatgcagagagacgtcttctgtgaccccgaggagcacaaacacacccgcaggcag
ctggaagacatccgcctggatggcaaccccatcaacctcagcctcttccccagcgcctac
ttctgcctgcctcggctccccatcggccgcttcacctag

DBGET integrated database retrieval system