KEGG   Pan paniscus (bonobo): 100989776
Entry
100989776         CDS       T02283                                 

Gene name
RORA
Definition
(RefSeq) RAR related orphan receptor A
  KO
K08532  RAR-related orphan receptor alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04659  Th17 cell differentiation
pps04710  Circadian rhythm
pps05017  Spinocerebellar ataxia
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100989776 (RORA)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100989776 (RORA)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100989776 (RORA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100989776 (RORA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100989776 (RORA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pps03310]
    100989776 (RORA)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100989776 (RORA)
Nuclear receptors [BR:pps03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   100989776 (RORA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100989776
NCBI-ProteinID: XP_003827972
Position
15
AA seq 525 aa
MRVTVAPQTKPVFSTNELAHLSPPSAPASQRESGVGLRASCPTEWGEKVVRGAFRGALRA
EKRPAATAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLID
RTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGE
AEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDING
IKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQI
TWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKA
GSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTED
EIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLR
ALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcgggtgaccgtagctccccagaccaaacctgtcttttccaccaacgagctggcgcat
ttatcgcccccgagtgctccggcgagccagcgggagagtggcgtcgggttgcgagcctct
tgccccaccgagtggggggagaaggtggtcagaggcgcgttccgcggggcgctgcgtgca
gaaaagcgaccggcggccacagctcaaattgaaattattccatgcaagatctgtggagac
aaatcatcaggaatccattatggtgtcattacatgtgaaggctgcaagggctttttcagg
agaagtcagcaaagcaatgccacctactcctgtcctcgtcagaagaactgtttgattgat
cgaaccagtagaaaccgctgccaacactgtcgattacagaaatgccttgccgtagggatg
tctcgagatgctgtaaaatttggccgaatgtcaaaaaagcagagagacagcttgtatgca
gaagtacagaaacaccggatgcagcagcagcagcgcgaccaccagcagcagcctggagag
gctgagccgctgacgcccacctacaacatctcggccaacgggctgacggaacttcacgac
gacctcagtaactacattgacgggcacacccctgaggggagtaaggcagactccgccgtc
agcagcttctacctggacatacagccttccccagaccagtcaggtcttgatatcaatgga
atcaaaccagaaccaatatgtgactacacaccagcatcaggcttctttccctactgttcg
ttcaccaacggcgagacttccccaactgtgtccatggcagaattagaacaccttgcacag
aatatatctaaatcgcatctggaaacctgccaatacttgagagaagagctccagcagata
acgtggcagacctttttacaggaagaaattgagaactatcaaaacaagcagcgggaggtg
atgtggcaattgtgtgccatcaaaattacagaagctatacagtatgtggtggagtttgcc
aaacgcattgatggatttatggaattgtgtcaaaatgatcaaattgtgcttctaaaagca
ggttctctagaggtggtgtttatcagaatgtgccgtgcctttgactctcagaacaacacc
gtgtactttgatgggaagtatgccagccccgacgtcttcaaatccttaggttgtgaagac
tttattagctttgtgtttgaatttggaaagagtttatgttctatgcacctgactgaagat
gaaattgcattattttctgcatttgtactgatgtcagcagatcgctcatggctgcaagaa
aaggtaaaaattgaaaaactgcaacagaaaattcagctagctcttcaacacgtcctacag
aagaatcaccgagaagatggaatactaacaaagttaatatgcaaggtgtctacattaaga
gccttatgtggacgacatacagaaaagctaatggcatttaaagcaatatacccagacatt
gtgcgacttcattttcctccattatacaaggagttgttcacttcagaatttgagccagca
atgcaaattgatgggtaa

DBGET integrated database retrieval system