KEGG   Pan paniscus (bonobo): 100989787
Entry
100989787         CDS       T02283                                 

Gene name
IL13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04664  Fc epsilon RI signaling pathway
pps05200  Pathways in cancer
pps05310  Asthma
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100989787 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100989787 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100989787 (IL13)
   04657 IL-17 signaling pathway
    100989787 (IL13)
   04664 Fc epsilon RI signaling pathway
    100989787 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100989787 (IL13)
  09163 Immune disease
   05310 Asthma
    100989787 (IL13)
   05321 Inflammatory bowel disease
    100989787 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100989787 (IL13)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100989787 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 100989787
NCBI-ProteinID: XP_003829348
UniProt: A0A2R9AD95
Position
5
AA seq 146 aa
MRPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
LCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
TKIEVAQFVKDLLLHLKKLFREGRFN
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcgtccgctcctcaatcctctcctgttggcactgggcctcatggcgcttttgttgacc
acggtcattgctctcacttgccttggcggctttgcctccccaggccctgtgcctccctct
acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggctccg
ctctgcaatggcagcatggtatggagcatcaacctgacagctggcgtgtactgtgcagcc
ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
agcggattctgcccgcacaaggtctcagctgggcagttttccagcttgcatgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacggttcaactga

DBGET integrated database retrieval system