KEGG   Pan paniscus (bonobo): 100989930Help
Entry
100989930         CDS       T02283                                 

Gene name
ROMO1
Definition
(RefSeq) reactive oxygen species modulator 1
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: Romo1 Tim17 TCRP1
Motif
Other DBs
NCBI-GeneID: 100989930
NCBI-ProteinID: XP_008955488
UniProt: A0A2R8ZQZ2
Position
20
AA seq 79 aa AA seqDB search
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggccgtgggtccctacggacagtcccagccaagctgcttcgaccgtgtcaag
atgggcttcgtgatgggttgcgccgtgggcatggcagccggggcgctcttcggcaccttt
tcctgtctcaggatcggaatgcggggtcgagagctgatgggcggcattgggaaaaccatg
atgcagagtggcggcacctttggcacattcatggccattgggatgggcatccgatgctaa

DBGET integrated database retrieval system