KEGG   Pan paniscus (bonobo): 100990031Help
Entry
100990031         CDS       T02283                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00500  Starch and sucrose metabolism
pps01100  Metabolic pathways
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04910  Insulin signaling pathway
pps04922  Glucagon signaling pathway
pps04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100990031 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100990031 (GYS1)
   04152 AMPK signaling pathway
    100990031 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100990031 (GYS1)
   04922 Glucagon signaling pathway
    100990031 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100990031 (GYS1)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100990031 (GYS1)
Glycosyltransferases [BR:pps01003]
 Polysaccharide
  Storage polysaccharide
   100990031 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100990031
NCBI-ProteinID: XP_003814337
Position
19
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacgcggtgctcttcgaagtggcctgggaggtggctaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggacgaatggggcgac
aactacttcctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaggacactggattccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgagggaggccctctggtggtgctcctggacgtgggt
gcctcagcttgggccctggagcgctggaagggagagctctgggatacctgcaacatcggg
gtgccgtggtacgaccgcgaggccaacgacgctgtcctctttggctttctgaccacctgg
ttcctgggtgagttcctggcacagagtgaggagaagccacatgtggttgctcacttccat
gagtggttggcaggcgttggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgccgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctaccac
cgctactgcatggaaagggcggcagcccactgcgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagcacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttatacttctttatcgccggccgctatgagttctccaacaagggtgctgac
gtcttcctggaggcattggctcggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgccttcttcatcatgccagcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagctgtgcgcaaacagctttgggacacagccaacacggtgaaggaaaagttc
gggaggaagctttatgaatccttactggttgggagccttcccgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgatttttcacccggag
ttcctctcctccacaagccccctgctccctgtggactatgaggagtttgtccgtggctgt
caccttggagtcttcccctcctactatgagccttggggctacacgccggctgagtgcacg
gttatgggaatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattcttgaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagtttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccaacgaggcggatgcggcccaggggtaccgctacccacggccagcc
tcggtgccaccatcgccctcgctgtcacgacactccagcccgcaccagagtgaggacgag
gaggatccccggaacgggccgctggaggaagacggcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacatccgtgcaccagagtggccgcgccgagcgtcctgcacc
tcctccaccagcggcagcaagcgcaactctgtggacacggccacctccagctcactcagc
accccgagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system