KEGG   Pan paniscus (bonobo): 100990082
Entry
100990082         CDS       T02283                                 

Gene name
FOXP3
Definition
(RefSeq) forkhead box P3
  KO
K10163  forkhead box P3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04659  Th17 cell differentiation
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100990082 (FOXP3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100990082 (FOXP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100990082 (FOXP3)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100990082 (FOXP3)
SSDB
Motif
Pfam: FOXP-CC Forkhead
Other DBs
NCBI-GeneID: 100990082
NCBI-ProteinID: XP_003807307
UniProt: A0A2R9A1N1
Position
X
AA seq 431 aa
MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSS
LNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQV
HPLESPAMISLPPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPGAPRKD
STLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQ
SLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPRE
APDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTL
NEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR
PSRCSNPTPGP
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgcccaatcccaggcctggcaagccctcggccccttccttggcccttggcccatcccca
ggagcctcgcccagctggagggctgcacccaaagcctcagacctgctgggggcccggggc
ccagggggaaccttccagggccgagatcttcgaggcggggcccatgcctcctcttcctcc
ttgaaccccatgccaccatcgcagctgcagctgcccacactgcccctagtcatggtggca
ccctccggggcacggctgggccccttgccccacttacaggcactcctccaggacaggcca
catttcatgcaccagctctcaacggtggatgcccacgcccggacccctgtgctgcaggtg
caccccctggagagcccagccatgatcagcctcccaccacccaccaccgccactggggtc
ttctccctcaaggcccggcctggcctcccacctgggatcaacgtggccagcctggaatgg
gtgtccagggagccggcactgctctgcaccttcccaaatcccggtgcacccaggaaggac
agcaccctttcggctgtgccccagagctcctacccactgctggcaaatggtgtctgcaag
tggcctggatgtgagaaggtcttcgaagagccagaggacttcctcaagcactgccaggcg
gaccatcttctggatgagaagggcagggcacaatgtctcctccagagagagatggtacag
tctctggagcagcagctggtgctggagaaggagaagctgagtgccatgcaggcccacctg
gctgggaaaatggcactgaccaaggcttcatctgtggcatcatccgacaagggctcctgc
tgcatcgtagctgctggcagccaaggccctgtcgtcccagcctggtctggcccccgggag
gcccctgacagcctgtttgctgtccggaggcacctgtggggtagccatggaaacagcaca
ttcccagagttcctccacaatatggactacttcaagttccacaacatgcgaccccctttc
acctacgccacgctcatccgctgggccatcctggaggctccagagaagcagcggacactc
aatgagatctaccactggttcacacgcatgtttgccttcttcagaaaccatcctgccacc
tggaagaacgccatccgccacaacctgagtctgcacaagtgctttgtgcgggtggaaagc
gagaagggggctgtgtggaccgtggatgagctggagttccgcaagaaacggagccagagg
cccagcaggtgttccaaccctacacctggcccctga

DBGET integrated database retrieval system