KEGG   Pan paniscus (bonobo): 100990225
Entry
100990225         CDS       T02283                                 

Gene name
SNX11
Definition
(RefSeq) sorting nexin 11
  KO
K17924  sorting nexin-10/11
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100990225 (SNX11)
Membrane trafficking [BR:pps04131]
 Protein recycling
  Others
   Others
    100990225 (SNX11)
SSDB
Motif
Pfam: PX
Other DBs
NCBI-GeneID: 100990225
NCBI-ProteinID: XP_003827544
UniProt: A0A2R9ARH1
Position
17
AA seq 270 aa
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRY
REFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDS
QLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKS
CCFLPRSGRRNSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEG
ASTLQSVRRAVGGDHAVPLDPGQLETVLEK
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcttttggtgtaggatgtcggagaaccaagaacaggaggaggtgattacagtgcgt
gttcaggacccccgagtgcagaatgagggctcctggaactcttatgtggattataagata
ttcctccataccaacagcaaagcctttactgccaagacttcctgtgtgcggcgccgctac
cgtgagttcgtatggctgagaaagcagctacagagaaatgctggtttggtgcctgttcct
gaacttcctgggaagtcaaccttcttcggcacctcagatgagttcattgagaagcgacga
caaggtctgcagcacttccttgaaaaggtcctgcagagtgtggttctcctgtcagacagc
cagttgcacctattcctgcaaagccagctctcggtgcctgagatagaagcctgtgtccag
ggccgaagtaccatgactgtgtctgatgccattcttcgatatgctatgtcaaactgtggc
tgggcccaggaagagaggcagagctcttctcacctggctaaaggagaccagcctaagagt
tgctgctttcttccaagatcgggtaggaggaactctccctcaccgcctcccagtgaagaa
aaggaccatttagaagtgtgggctccagttgttgactctgaggttccttccttggaaagt
cccactctcccacccctctcctcaccattatgctgtgattttggaagacccaaagaggga
gcctccactcttcagtctgtgaggagggctgtgggaggagatcatgctgtgcctttggac
cctggtcagttagaaacagttttggaaaagtga

DBGET integrated database retrieval system