KEGG   Pan paniscus (bonobo): 100990499
Entry
100990499         CDS       T02283                                 

Gene name
AURKC
Definition
(RefSeq) aurora kinase C
  KO
K11480  aurora kinase C [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100990499 (AURKC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100990499 (AURKC)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100990499 (AURKC)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   100990499 (AURKC)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100990499 (AURKC)
  Sister chromatid separation proteins
   Aurora kinases
    100990499 (AURKC)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 100990499
NCBI-ProteinID: XP_003816716
UniProt: A0A2R9C9K6
Position
19
AA seq 309 aa
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTIDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagctcccccagagctgtggtgcagctgggcaaagctcaacctgcaggcgaagagttg
gctacagcaaaccaaacagcccagcagcccagcagcccagccatgcggcgcctcacaatc
gatgactttgaaatcgggcgtcccctgggcaaggggaaatttgggaatgtgtacctggct
cggctcaaggaaagccatttcattgtggccctgaaggttctcttcaagtcgcagatagag
aaggaaggactggagcaccagctgcgccgggaaattgagatccaggcgcatctacaacac
cccaatatcctgcgcctgtataactatttccatgatgcacgccgggtgtacctgattctg
gaatatgctccaaggggtgagctctacaaggagctgcaaaaaagcgagaaattagatgaa
cagcgcacagccacgataatagaggagttggcagatgccctgacctactgccatgacaag
aaagtgattcacagagatattaagccagagaacctgctgctggggttcaggggtgaggtg
aagattgcagattttggctggtctgtgcacaccccctccctgaggaggaagacaatgtgt
gggacactggactacttgcccccagaaatgattgaggggcgaacatatgatgaaaaggtg
gacttgtggtgcattggagtgctctgctatgagctgctggtgggatatccaccctttgag
agcgcctcccacagtgagacttacagacgcatcctcaaggtagatgtgaggtttccacta
tcaatgcctctgggggcccgggacttgatttccaggcttctcagataccagcccttggag
agactgcccctggcccagatcctgaagcacccctgggttcaggcccactcccgaagggtg
ctgcctccctgtgctcagatggcttcctga

DBGET integrated database retrieval system